Details of the Target

General Information of Target

Target ID LDTP04945
Target Name Small ubiquitin-related modifier 2 (SUMO2)
Gene Name SUMO2
Gene ID 6613
Synonyms
SMT3B; SMT3H2; Small ubiquitin-related modifier 2; SUMO-2; HSMT3; SMT3 homolog 2; SUMO-3; Sentrin-2; Ubiquitin-like protein SMT3B; Smt3B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Target Bioclass
Other
Family
Ubiquitin family, SUMO subfamily
Subcellular location
Nucleus
Function
Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX.
Uniprot ID
P61956
Ensemble ID
ENST00000314523.7
HGNC ID
HGNC:11125
ChEMBL ID
CHEMBL2146301

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
SW1990 SNV: p.M1? .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		4.43  LDD0393  [1]
ONAyne
 Probe Info  		K11(10.00)  LDD0274  [2]
STPyne
 Probe Info  		K11(6.97); K33(5.54); K42(8.65); K45(7.90)  LDD0277  [2]
ATP probe
 Probe Info  		K11(0.00); K7(0.00)  LDD0199  [3]
m-APA
 Probe Info  		N.A.  LDD2231  [4]
NHS
 Probe Info  		K11(0.00); K21(0.00); K33(0.00); K42(0.00)  LDD0010  [5]
SF
 Probe Info  		N.A.  LDD0028  [6]
Acrolein
 Probe Info  		N.A.  LDD0217  [7]
HHS-465
 Probe Info  		K33(0.00); K45(0.00); Y47(0.00); K42(0.00)  LDD2240  [8]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C187
 Probe Info  		18.25  LDD1865  [9]
C191
 Probe Info  		12.73  LDD1868  [9]
C193
 Probe Info  		7.06  LDD1869  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [7]
 LDCM0107  IAA HeLa N.A.  LDD0221  [7]
 LDCM0109  NEM HeLa N.A.  LDD0223  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SUMO-specific isopeptidase USPL1 (USPL1) Peptidase C19 family Q5W0Q7
Ubiquitin carboxyl-terminal hydrolase 25 (USP25) Peptidase C19 family Q9UHP3
Sentrin-specific protease 1 (SENP1) Peptidase C48 family Q9P0U3
Sentrin-specific protease 2 (SENP2) Peptidase C48 family Q9HC62
E3 SUMO-protein ligase PIAS4 (PIAS4) PIAS family Q8N2W9
Chromodomain-helicase-DNA-binding protein 3 (CHD3) SNF2/RAD54 helicase family Q12873
SUMO-conjugating enzyme UBC9 (UBE2I) Ubiquitin-conjugating enzyme family P63279
G/T mismatch-specific thymine DNA glycosylase (TDG) TDG/mug family Q13569
Breast cancer type 1 susceptibility protein (BRCA1) . P38398
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 39 (ZBTB39) Krueppel C2H2-type zinc-finger protein family O15060
Zinc finger protein 496 (ZNF496) Krueppel C2H2-type zinc-finger protein family Q96IT1
Transcriptional activator Myb (MYB) . P10242
Transcriptional regulator Kaiso (ZBTB33) . Q86T24
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proline-, glutamic acid- and leucine-rich protein 1 (PELP1) RIX1/PELP1 family Q8IZL8
TRAF family member-associated NF-kappa-B activator (TANK) . Q92844

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
6 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
7 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
8 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
9 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587