Details of the Target

General Information of Target

Target ID LDTP04723
Target Name ATP synthase subunit f, mitochondrial (ATP5MF)
Gene Name ATP5MF
Gene ID 9551
Synonyms
ATP5J2; ATP5JL; ATP synthase subunit f, mitochondrial; ATP synthase membrane subunit f
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKK
GSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Target Bioclass
Transporter and channel
Family
ATPase F chain family
Subcellular location
Mitochondrion
Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Uniprot ID
P56134
Ensemble ID
ENST00000292475.8
HGNC ID
HGNC:848

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y55(20.00)  LDD0260  [1]
STPyne
 Probe Info  		K54(1.97); K59(1.20); K86(2.93)  LDD0277  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [3]
IPM
 Probe Info  		N.A.  LDD0025  [4]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [4]
TFBX
 Probe Info  		N.A.  LDD0027  [4]
WYneN
 Probe Info  		N.A.  LDD0021  [5]
ENE
 Probe Info  		N.A.  LDD0006  [5]
PF-06672131
 Probe Info  		N.A.  LDD0152  [6]
PPMS
 Probe Info  		N.A.  LDD0008  [5]
VSF
 Probe Info  		N.A.  LDD0007  [5]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [7]
1c-yne
 Probe Info  		N.A.  LDD0228  [8]
NAIA_5
 Probe Info  		C72(0.00); C7(0.00)  LDD2223  [9]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C092
 Probe Info  		17.51  LDD1783  [10]
C094
 Probe Info  		23.43  LDD1785  [10]
C112
 Probe Info  		18.64  LDD1799  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0632  CL-Sc Hep-G2 C7(1.65); C7(1.12); C7(0.90)  LDD2227  [9]
 LDCM0634  CY-0357 Hep-G2 C7(1.25)  LDD2228  [9]
 LDCM0625  F8 Ramos C7(1.22)  LDD2187  [11]
 LDCM0572  Fragment10 Ramos C7(1.21)  LDD2189  [11]
 LDCM0573  Fragment11 Ramos C7(8.47)  LDD2190  [11]
 LDCM0574  Fragment12 Ramos C7(1.56)  LDD2191  [11]
 LDCM0575  Fragment13 Ramos C7(1.04)  LDD2192  [11]
 LDCM0576  Fragment14 Ramos C7(1.47)  LDD2193  [11]
 LDCM0579  Fragment20 Ramos C7(1.95)  LDD2194  [11]
 LDCM0580  Fragment21 Ramos C7(1.03)  LDD2195  [11]
 LDCM0582  Fragment23 Ramos C7(1.07)  LDD2196  [11]
 LDCM0578  Fragment27 Ramos C7(0.94)  LDD2197  [11]
 LDCM0586  Fragment28 Ramos C7(0.69)  LDD2198  [11]
 LDCM0588  Fragment30 Ramos C7(1.31)  LDD2199  [11]
 LDCM0589  Fragment31 Ramos C7(0.94)  LDD2200  [11]
 LDCM0590  Fragment32 Ramos C7(1.59)  LDD2201  [11]
 LDCM0468  Fragment33 Ramos C7(1.02)  LDD2202  [11]
 LDCM0596  Fragment38 Ramos C7(1.09)  LDD2203  [11]
 LDCM0566  Fragment4 Ramos C7(1.20)  LDD2184  [11]
 LDCM0610  Fragment52 Ramos C7(1.53)  LDD2204  [11]
 LDCM0614  Fragment56 Ramos C7(1.17)  LDD2205  [11]
 LDCM0569  Fragment7 Ramos C7(1.51)  LDD2186  [11]
 LDCM0571  Fragment9 Ramos C7(1.23)  LDD2188  [11]
 LDCM0022  KB02 Ramos C7(2.11)  LDD2182  [11]
 LDCM0023  KB03 Ramos C7(2.24)  LDD2183  [11]
 LDCM0024  KB05 Ramos C7(2.18)  LDD2185  [11]
 LDCM0627  NUDT7-COV-1 HEK-293T C7(1.05); C7(0.94); C7(0.80)  LDD2206  [12]
 LDCM0628  OTUB2-COV-1 HEK-293T C7(0.75); C7(0.41)  LDD2207  [12]

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
6 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
7 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
8 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
10 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
11 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
12 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.