General Information of Target

Target ID LDTP03627
Target Name Beta-arrestin-2 (ARRB2)
Gene Name ARRB2
Gene ID 409
Synonyms
ARB2; ARR2; Beta-arrestin-2; Arrestin beta-2; Non-visual arrestin-3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Target Type
Literature-reported
Target Bioclass
Transporter and channel
Family
Arrestin family
Subcellular location
Cytoplasm
Function
Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptor determinants exposed only in the active receptor conformation. The beta-arrestins target many receptors for internalization by acting as endocytic adapters (CLASPs, clathrin-associated sorting proteins) and recruiting the GPRCs to the adapter protein 2 complex 2 (AP-2) in clathrin-coated pits (CCPs). However, the extent of beta-arrestin involvement appears to vary significantly depending on the receptor, agonist and cell type. Internalized arrestin-receptor complexes traffic to intracellular endosomes, where they remain uncoupled from G-proteins. Two different modes of arrestin-mediated internalization occur. Class A receptors, like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapid recycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR and TACR1 internalize as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptors, for extended periods of time. Receptor resensitization then requires that receptor-bound arrestin is removed so that the receptor can be dephosphorylated and returned to the plasma membrane. Mediates endocytosis of CCR7 following ligation of CCL19 but not CCL21. Involved in internalization of P2RY1, P2RY4, P2RY6 and P2RY11 and ATP-stimulated internalization of P2RY2. Involved in phosphorylation-dependent internalization of OPRD1 and subsequent recycling or degradation. Involved in ubiquitination of IGF1R. Beta-arrestins function as multivalent adapter proteins that can switch the GPCR from a G-protein signaling mode that transmits short-lived signals from the plasma membrane via small molecule second messengers and ion channels to a beta-arrestin signaling mode that transmits a distinct set of signals that are initiated as the receptor internalizes and transits the intracellular compartment. Acts as a signaling scaffold for MAPK pathways such as MAPK1/3 (ERK1/2) and MAPK10 (JNK3). ERK1/2 and JNK3 activated by the beta-arrestin scaffold are largely excluded from the nucleus and confined to cytoplasmic locations such as endocytic vesicles, also called beta-arrestin signalosomes. Acts as a signaling scaffold for the AKT1 pathway. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependent regulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs the beta-arrestin-mediated signaling relies on either ARRB1 or ARRB2 and is inhibited by the other respective beta-arrestin form (reciprocal regulation). Increases ERK1/2 signaling in AGTR1- and AVPR2-mediated activation (reciprocal regulation). Involved in CCR7-mediated ERK1/2 signaling involving ligand CCL19. Is involved in type-1A angiotensin II receptor/AGTR1-mediated ERK activity. Is involved in type-1A angiotensin II receptor/AGTR1-mediated MAPK10 activity. Is involved in dopamine-stimulated AKT1 activity in the striatum by disrupting the association of AKT1 with its negative regulator PP2A. Involved in AGTR1-mediated chemotaxis. Appears to function as signaling scaffold involved in regulation of MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved in attenuation of NF-kappa-B-dependent transcription in response to GPCR or cytokine stimulation by interacting with and stabilizing CHUK. Suppresses UV-induced NF-kappa-B-dependent activation by interacting with CHUK. The function is promoted by stimulation of ADRB2 and dephosphorylation of ARRB2. Involved in p53/TP53-mediated apoptosis by regulating MDM2 and reducing the MDM2-mediated degradation of p53/TP53. May serve as nuclear messenger for GPCRs. Upon stimulation of OR1D2, may be involved in regulation of gene expression during the early processes of fertilization. Also involved in regulation of receptors other than GPCRs. Involved in endocytosis of TGFBR2 and TGFBR3 and down-regulates TGF-beta signaling such as NF-kappa-B activation. Involved in endocytosis of low-density lipoprotein receptor/LDLR. Involved in endocytosis of smoothened homolog/Smo, which also requires GRK2. Involved in endocytosis of SLC9A5. Involved in endocytosis of ENG and subsequent TGF-beta-mediated ERK activation and migration of epithelial cells. Involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6 which prevents TRAF6 autoubiquitination and oligomerization required for activation of NF-kappa-B and JUN. Involved in insulin resistance by acting as insulin-induced signaling scaffold for SRC, AKT1 and INSR. Involved in regulation of inhibitory signaling of natural killer cells by recruiting PTPN6 and PTPN11 to KIR2DL1. Involved in IL8-mediated granule release in neutrophils. Involved in the internalization of the atypical chemokine receptor ACKR3. Acts as an adapter protein coupling FFAR4 receptor to specific downstream signaling pathways, as well as mediating receptor endocytosis. During the activation step of NLRP3 inflammasome, directly associates with NLRP3 leading to inhibition of pro-inflammatory cytokine release and inhibition of inflammation.
TTD ID
T16243
Uniprot ID
P32121
DrugMap ID
TT8SO2I
Ensemble ID
ENST00000269260.7
HGNC ID
HGNC:712

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
JURKAT SNV: p.D402N Compound 10    Probe Info 
REH SNV: p.D68Y DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 14 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
14.16  LDD0403  [1]
DBIA
 Probe Info 
C162(1.40)  LDD3312  [2]
AHL-Pu-1
 Probe Info 
C270(3.71)  LDD0169  [3]
AMP probe
 Probe Info 
N.A.  LDD0200  [4]
ATP probe
 Probe Info 
N.A.  LDD0199  [4]
4-Iodoacetamidophenylacetylene
 Probe Info 
C141(0.00); C126(0.00); C409(0.00); C243(0.00)  LDD0038  [5]
IA-alkyne
 Probe Info 
C141(0.00); C409(0.00); C60(0.00); C126(0.00)  LDD0036  [5]
Lodoacetamide azide
 Probe Info 
C141(0.00); C126(0.00)  LDD0037  [5]
Compound 10
 Probe Info 
N.A.  LDD2216  [6]
Compound 11
 Probe Info 
N.A.  LDD2213  [6]
IPM
 Probe Info 
N.A.  LDD0147  [7]
STPyne
 Probe Info 
N.A.  LDD0009  [8]
TFBX
 Probe Info 
N.A.  LDD0148  [7]
AOyne
 Probe Info 
15.00  LDD0443  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA HEK-293T C270(3.71)  LDD0169  [3]
 LDCM0214  AC1 HEK-293T C141(0.91); C270(1.00)  LDD1507  [10]
 LDCM0215  AC10 HEK-293T C141(0.92); C270(1.09)  LDD1508  [10]
 LDCM0226  AC11 HEK-293T C141(1.04); C270(0.90)  LDD1509  [10]
 LDCM0237  AC12 HEK-293T C141(0.89); C270(1.02)  LDD1510  [10]
 LDCM0259  AC14 HEK-293T C141(0.92); C126(1.02); C270(1.01)  LDD1512  [10]
 LDCM0270  AC15 HEK-293T C141(0.93); C270(1.12)  LDD1513  [10]
 LDCM0276  AC17 HEK-293T C141(0.93); C270(1.01)  LDD1515  [10]
 LDCM0277  AC18 HEK-293T C141(0.97); C270(1.16)  LDD1516  [10]
 LDCM0278  AC19 HEK-293T C141(0.82); C270(0.88)  LDD1517  [10]
 LDCM0279  AC2 HEK-293T C141(1.04); C270(1.05)  LDD1518  [10]
 LDCM0280  AC20 HEK-293T C141(0.80); C270(1.03)  LDD1519  [10]
 LDCM0281  AC21 HEK-293T C141(0.95)  LDD1520  [10]
 LDCM0282  AC22 HEK-293T C141(0.91); C126(0.95); C270(0.90)  LDD1521  [10]
 LDCM0283  AC23 HEK-293T C141(1.00); C270(1.01)  LDD1522  [10]
 LDCM0284  AC24 HEK-293T C141(1.05); C126(1.08); C270(1.18)  LDD1523  [10]
 LDCM0285  AC25 HEK-293T C141(0.91); C270(1.05)  LDD1524  [10]
 LDCM0286  AC26 HEK-293T C141(0.95); C270(1.01)  LDD1525  [10]
 LDCM0287  AC27 HEK-293T C141(1.03); C270(0.99)  LDD1526  [10]
 LDCM0288  AC28 HEK-293T C141(0.74); C270(0.97)  LDD1527  [10]
 LDCM0289  AC29 HEK-293T C141(1.01)  LDD1528  [10]
 LDCM0290  AC3 HEK-293T C141(1.05); C270(0.91)  LDD1529  [10]
 LDCM0291  AC30 HEK-293T C141(0.93); C126(0.96); C270(1.01)  LDD1530  [10]
 LDCM0292  AC31 HEK-293T C141(0.91); C270(1.06)  LDD1531  [10]
 LDCM0293  AC32 HEK-293T C141(0.96); C126(1.02); C270(1.26)  LDD1532  [10]
 LDCM0294  AC33 HEK-293T C141(0.89); C270(1.08)  LDD1533  [10]
 LDCM0295  AC34 HEK-293T C141(0.93); C270(1.02)  LDD1534  [10]
 LDCM0296  AC35 HEK-293T C141(1.11); C270(0.92)  LDD1535  [10]
 LDCM0297  AC36 HEK-293T C141(0.80); C270(1.01)  LDD1536  [10]
 LDCM0298  AC37 HEK-293T C141(1.16)  LDD1537  [10]
 LDCM0299  AC38 HEK-293T C141(0.91); C126(1.02); C270(0.96)  LDD1538  [10]
 LDCM0300  AC39 HEK-293T C141(0.86); C270(0.92)  LDD1539  [10]
 LDCM0301  AC4 HEK-293T C141(0.79); C270(1.00)  LDD1540  [10]
 LDCM0302  AC40 HEK-293T C141(1.11); C126(1.07); C270(1.18)  LDD1541  [10]
 LDCM0303  AC41 HEK-293T C141(0.86); C270(0.94)  LDD1542  [10]
 LDCM0304  AC42 HEK-293T C141(0.95); C270(1.01)  LDD1543  [10]
 LDCM0305  AC43 HEK-293T C141(0.99); C270(1.00)  LDD1544  [10]
 LDCM0306  AC44 HEK-293T C141(0.88); C270(1.07)  LDD1545  [10]
 LDCM0307  AC45 HEK-293T C141(0.99)  LDD1546  [10]
 LDCM0308  AC46 HEK-293T C141(0.86); C126(1.11); C270(1.14)  LDD1547  [10]
 LDCM0309  AC47 HEK-293T C141(0.89); C270(1.05)  LDD1548  [10]
 LDCM0310  AC48 HEK-293T C141(1.07); C126(0.97); C270(1.15)  LDD1549  [10]
 LDCM0311  AC49 HEK-293T C141(0.91); C270(0.94)  LDD1550  [10]
 LDCM0312  AC5 HEK-293T C141(1.07)  LDD1551  [10]
 LDCM0313  AC50 HEK-293T C141(0.94); C270(1.06)  LDD1552  [10]
 LDCM0314  AC51 HEK-293T C141(1.17); C270(0.96)  LDD1553  [10]
 LDCM0315  AC52 HEK-293T C141(0.84); C270(0.91)  LDD1554  [10]
 LDCM0316  AC53 HEK-293T C141(1.11)  LDD1555  [10]
 LDCM0317  AC54 HEK-293T C141(0.93); C126(1.01); C270(1.14)  LDD1556  [10]
 LDCM0318  AC55 HEK-293T C141(0.93); C270(1.05)  LDD1557  [10]
 LDCM0319  AC56 HEK-293T C141(0.95); C126(1.05); C270(1.26)  LDD1558  [10]
 LDCM0320  AC57 HEK-293T C141(0.98); C270(1.04)  LDD1559  [10]
 LDCM0321  AC58 HEK-293T C141(0.96); C270(1.07)  LDD1560  [10]
 LDCM0322  AC59 HEK-293T C141(1.14); C270(1.01)  LDD1561  [10]
 LDCM0323  AC6 HEK-293T C141(0.89); C126(0.94); C270(1.14)  LDD1562  [10]
 LDCM0324  AC60 HEK-293T C141(0.79); C270(0.92)  LDD1563  [10]
 LDCM0325  AC61 HEK-293T C141(0.96)  LDD1564  [10]
 LDCM0326  AC62 HEK-293T C141(0.88); C126(1.06); C270(1.01)  LDD1565  [10]
 LDCM0327  AC63 HEK-293T C141(0.91); C270(0.98)  LDD1566  [10]
 LDCM0328  AC64 HEK-293T C141(1.03); C126(1.08); C270(1.24)  LDD1567  [10]
 LDCM0334  AC7 HEK-293T C141(1.00); C270(0.99)  LDD1568  [10]
 LDCM0345  AC8 HEK-293T C141(0.99); C126(1.06); C270(1.22)  LDD1569  [10]
 LDCM0248  AKOS034007472 HEK-293T C141(1.11)  LDD1511  [10]
 LDCM0356  AKOS034007680 HEK-293T C141(0.88); C270(0.95)  LDD1570  [10]
 LDCM0275  AKOS034007705 HEK-293T C141(0.96); C126(0.98); C270(1.22)  LDD1514  [10]
 LDCM0156  Aniline NCI-H1299 14.16  LDD0403  [1]
 LDCM0367  CL1 HEK-293T C141(1.10); C270(0.92)  LDD1571  [10]
 LDCM0368  CL10 HEK-293T C141(0.88); C126(0.84); C270(0.90)  LDD1572  [10]
 LDCM0369  CL100 HEK-293T C141(0.94); C126(1.01); C270(0.92)  LDD1573  [10]
 LDCM0370  CL101 HEK-293T C141(1.06); C270(1.06)  LDD1574  [10]
 LDCM0371  CL102 HEK-293T C141(1.02); C270(0.98)  LDD1575  [10]
 LDCM0372  CL103 HEK-293T C141(1.08); C270(1.11)  LDD1576  [10]
 LDCM0373  CL104 HEK-293T C141(1.01); C126(1.11); C270(1.10)  LDD1577  [10]
 LDCM0374  CL105 HEK-293T C141(1.00); C270(0.92)  LDD1578  [10]
 LDCM0375  CL106 HEK-293T C141(0.85); C270(0.93)  LDD1579  [10]
 LDCM0376  CL107 HEK-293T C141(0.98); C270(1.19)  LDD1580  [10]
 LDCM0377  CL108 HEK-293T C141(0.93); C126(0.89); C270(1.08)  LDD1581  [10]
 LDCM0378  CL109 HEK-293T C141(0.98); C270(0.93)  LDD1582  [10]
 LDCM0379  CL11 HEK-293T C141(0.94); C270(0.99)  LDD1583  [10]
 LDCM0380  CL110 HEK-293T C141(0.79); C270(0.80)  LDD1584  [10]
 LDCM0381  CL111 HEK-293T C141(0.95); C270(1.03)  LDD1585  [10]
 LDCM0382  CL112 HEK-293T C141(0.98); C126(0.88); C270(0.89)  LDD1586  [10]
 LDCM0383  CL113 HEK-293T C141(1.06); C270(0.89)  LDD1587  [10]
 LDCM0384  CL114 HEK-293T C141(0.88); C270(0.90)  LDD1588  [10]
 LDCM0385  CL115 HEK-293T C141(1.17); C270(1.07)  LDD1589  [10]
 LDCM0386  CL116 HEK-293T C141(1.04); C126(1.09); C270(0.97)  LDD1590  [10]
 LDCM0387  CL117 HEK-293T C141(1.12); C270(1.08)  LDD1591  [10]
 LDCM0388  CL118 HEK-293T C141(0.98); C270(1.02)  LDD1592  [10]
 LDCM0389  CL119 HEK-293T C141(1.13); C270(1.09)  LDD1593  [10]
 LDCM0390  CL12 HEK-293T C141(0.98); C126(1.14); C270(1.39)  LDD1594  [10]
 LDCM0391  CL120 HEK-293T C141(1.01); C126(0.85); C270(1.21)  LDD1595  [10]
 LDCM0392  CL121 HEK-293T C141(1.08); C270(0.99)  LDD1596  [10]
 LDCM0393  CL122 HEK-293T C141(0.91); C270(1.05)  LDD1597  [10]
 LDCM0394  CL123 HEK-293T C141(1.00); C270(0.99)  LDD1598  [10]
 LDCM0395  CL124 HEK-293T C141(0.95); C126(0.90); C270(0.96)  LDD1599  [10]
 LDCM0396  CL125 HEK-293T C141(1.09); C270(1.01)  LDD1600  [10]
 LDCM0397  CL126 HEK-293T C141(0.91); C270(1.11)  LDD1601  [10]
 LDCM0398  CL127 HEK-293T C141(1.09); C270(1.14)  LDD1602  [10]
 LDCM0399  CL128 HEK-293T C141(1.02); C126(1.27); C270(0.98)  LDD1603  [10]
 LDCM0400  CL13 HEK-293T C141(1.08); C270(1.08)  LDD1604  [10]
 LDCM0401  CL14 HEK-293T C141(0.83); C270(1.16)  LDD1605  [10]
 LDCM0402  CL15 HEK-293T C141(1.00); C270(1.02)  LDD1606  [10]
 LDCM0403  CL16 HEK-293T C141(1.04); C126(1.01); C270(1.09)  LDD1607  [10]
 LDCM0404  CL17 HEK-293T C141(0.76); C270(0.86)  LDD1608  [10]
 LDCM0405  CL18 HEK-293T C141(0.93); C270(1.14)  LDD1609  [10]
 LDCM0406  CL19 HEK-293T C141(1.11); C270(0.87)  LDD1610  [10]
 LDCM0407  CL2 HEK-293T C141(0.84); C270(1.03)  LDD1611  [10]
 LDCM0408  CL20 HEK-293T C141(0.97); C270(1.00)  LDD1612  [10]
 LDCM0409  CL21 HEK-293T C141(1.05)  LDD1613  [10]
 LDCM0410  CL22 HEK-293T C141(1.03); C126(0.91); C270(1.03)  LDD1614  [10]
 LDCM0411  CL23 HEK-293T C141(1.04); C270(0.93)  LDD1615  [10]
 LDCM0412  CL24 HEK-293T C141(0.91); C126(0.95); C270(1.21)  LDD1616  [10]
 LDCM0413  CL25 HEK-293T C141(0.90); C270(0.96)  LDD1617  [10]
 LDCM0414  CL26 HEK-293T C141(0.84); C270(1.03)  LDD1618  [10]
 LDCM0415  CL27 HEK-293T C141(1.05); C270(1.10)  LDD1619  [10]
 LDCM0416  CL28 HEK-293T C141(1.01); C126(0.72); C270(1.21)  LDD1620  [10]
 LDCM0417  CL29 HEK-293T C141(0.94); C270(1.15)  LDD1621  [10]
 LDCM0418  CL3 HEK-293T C141(1.11); C270(1.12)  LDD1622  [10]
 LDCM0419  CL30 HEK-293T C141(1.02); C270(1.06)  LDD1623  [10]
 LDCM0420  CL31 HEK-293T C141(0.93); C270(0.85)  LDD1624  [10]
 LDCM0421  CL32 HEK-293T C141(0.84); C270(0.95)  LDD1625  [10]
 LDCM0422  CL33 HEK-293T C141(0.95)  LDD1626  [10]
 LDCM0423  CL34 HEK-293T C141(0.98); C126(0.83); C270(0.94)  LDD1627  [10]
 LDCM0424  CL35 HEK-293T C141(1.02); C270(1.07)  LDD1628  [10]
 LDCM0425  CL36 HEK-293T C141(1.02); C126(1.11); C270(1.06)  LDD1629  [10]
 LDCM0426  CL37 HEK-293T C141(1.01); C270(0.92)  LDD1630  [10]
 LDCM0428  CL39 HEK-293T C141(1.08); C270(1.16)  LDD1632  [10]
 LDCM0429  CL4 HEK-293T C141(0.99); C126(0.97); C270(1.01)  LDD1633  [10]
 LDCM0430  CL40 HEK-293T C141(1.00); C126(1.04); C270(0.98)  LDD1634  [10]
 LDCM0431  CL41 HEK-293T C141(0.84); C270(0.97)  LDD1635  [10]
 LDCM0432  CL42 HEK-293T C141(1.05); C270(1.12)  LDD1636  [10]
 LDCM0433  CL43 HEK-293T C141(0.91); C270(0.95)  LDD1637  [10]
 LDCM0434  CL44 HEK-293T C141(0.93); C270(0.93)  LDD1638  [10]
 LDCM0435  CL45 HEK-293T C141(1.06)  LDD1639  [10]
 LDCM0436  CL46 HEK-293T C141(1.07); C126(0.93); C270(0.92)  LDD1640  [10]
 LDCM0437  CL47 HEK-293T C141(1.06); C270(0.97)  LDD1641  [10]
 LDCM0438  CL48 HEK-293T C141(1.01); C126(0.95); C270(1.13)  LDD1642  [10]
 LDCM0439  CL49 HEK-293T C141(1.06); C270(0.97)  LDD1643  [10]
 LDCM0440  CL5 HEK-293T C141(0.96); C270(1.05)  LDD1644  [10]
 LDCM0441  CL50 HEK-293T C141(0.87); C270(1.02)  LDD1645  [10]
 LDCM0443  CL52 HEK-293T C141(1.07); C126(0.89); C270(1.15)  LDD1646  [10]
 LDCM0444  CL53 HEK-293T C141(0.80); C270(0.89)  LDD1647  [10]
 LDCM0445  CL54 HEK-293T C141(0.79); C270(0.82)  LDD1648  [10]
 LDCM0446  CL55 HEK-293T C141(1.01); C270(0.94)  LDD1649  [10]
 LDCM0447  CL56 HEK-293T C141(0.75); C270(0.99)  LDD1650  [10]
 LDCM0448  CL57 HEK-293T C141(1.02)  LDD1651  [10]
 LDCM0449  CL58 HEK-293T C141(0.95); C126(1.13); C270(1.02)  LDD1652  [10]
 LDCM0450  CL59 HEK-293T C141(1.03); C270(0.97)  LDD1653  [10]
 LDCM0451  CL6 HEK-293T C141(0.87); C270(1.11)  LDD1654  [10]
 LDCM0452  CL60 HEK-293T C141(1.04); C126(1.01); C270(1.30)  LDD1655  [10]
 LDCM0453  CL61 HEK-293T C141(1.05); C270(0.86)  LDD1656  [10]
 LDCM0454  CL62 HEK-293T C141(0.96); C270(1.04)  LDD1657  [10]
 LDCM0455  CL63 HEK-293T C141(1.12); C270(1.11)  LDD1658  [10]
 LDCM0456  CL64 HEK-293T C141(0.96); C126(1.06); C270(1.02)  LDD1659  [10]
 LDCM0457  CL65 HEK-293T C141(0.90); C270(0.86)  LDD1660  [10]
 LDCM0458  CL66 HEK-293T C141(0.93); C270(1.08)  LDD1661  [10]
 LDCM0459  CL67 HEK-293T C141(1.05); C270(1.04)  LDD1662  [10]
 LDCM0460  CL68 HEK-293T C141(0.84); C270(0.85)  LDD1663  [10]
 LDCM0461  CL69 HEK-293T C141(1.02)  LDD1664  [10]
 LDCM0462  CL7 HEK-293T C141(1.15); C270(0.95)  LDD1665  [10]
 LDCM0463  CL70 HEK-293T C141(0.96); C126(1.03); C270(0.97)  LDD1666  [10]
 LDCM0464  CL71 HEK-293T C141(0.92); C270(0.92)  LDD1667  [10]
 LDCM0465  CL72 HEK-293T C141(1.02); C126(1.14); C270(1.17)  LDD1668  [10]
 LDCM0466  CL73 HEK-293T C141(1.05); C270(0.93)  LDD1669  [10]
 LDCM0467  CL74 HEK-293T C141(1.02); C270(1.06)  LDD1670  [10]
 LDCM0469  CL76 HEK-293T C141(1.00); C126(1.57); C270(0.98)  LDD1672  [10]
 LDCM0470  CL77 HEK-293T C141(0.78); C270(0.80)  LDD1673  [10]
 LDCM0471  CL78 HEK-293T C141(0.97); C270(1.11)  LDD1674  [10]
 LDCM0472  CL79 HEK-293T C141(1.09); C270(0.95)  LDD1675  [10]
 LDCM0473  CL8 HEK-293T C141(0.73); C270(0.81)  LDD1676  [10]
 LDCM0474  CL80 HEK-293T C141(0.88); C270(0.85)  LDD1677  [10]
 LDCM0475  CL81 HEK-293T C141(1.14)  LDD1678  [10]
 LDCM0476  CL82 HEK-293T C141(1.02); C126(1.02); C270(0.98)  LDD1679  [10]
 LDCM0477  CL83 HEK-293T C141(0.94); C270(0.88)  LDD1680  [10]
 LDCM0478  CL84 HEK-293T C141(0.96); C126(0.98); C270(1.03)  LDD1681  [10]
 LDCM0479  CL85 HEK-293T C141(1.11); C270(1.03)  LDD1682  [10]
 LDCM0480  CL86 HEK-293T C141(0.76); C270(1.02)  LDD1683  [10]
 LDCM0481  CL87 HEK-293T C141(1.06); C270(1.16)  LDD1684  [10]
 LDCM0482  CL88 HEK-293T C141(1.11); C126(1.02); C270(1.10)  LDD1685  [10]
 LDCM0483  CL89 HEK-293T C141(0.94); C270(1.09)  LDD1686  [10]
 LDCM0484  CL9 HEK-293T C141(1.07)  LDD1687  [10]
 LDCM0485  CL90 HEK-293T C141(0.81); C270(0.80)  LDD1688  [10]
 LDCM0486  CL91 HEK-293T C141(1.17); C270(1.07)  LDD1689  [10]
 LDCM0487  CL92 HEK-293T C141(0.65); C270(0.94)  LDD1690  [10]
 LDCM0488  CL93 HEK-293T C141(1.10)  LDD1691  [10]
 LDCM0489  CL94 HEK-293T C141(0.96); C126(0.88); C270(1.04)  LDD1692  [10]
 LDCM0490  CL95 HEK-293T C141(0.76); C270(0.94)  LDD1693  [10]
 LDCM0491  CL96 HEK-293T C141(0.86); C126(1.07); C270(1.05)  LDD1694  [10]
 LDCM0492  CL97 HEK-293T C141(1.06); C270(0.99)  LDD1695  [10]
 LDCM0493  CL98 HEK-293T C141(0.99); C270(1.00)  LDD1696  [10]
 LDCM0494  CL99 HEK-293T C141(1.05); C270(1.35)  LDD1697  [10]
 LDCM0495  E2913 HEK-293T C141(1.05); C270(1.27)  LDD1698  [10]
 LDCM0468  Fragment33 HEK-293T C141(1.12); C270(1.10)  LDD1671  [10]
 LDCM0427  Fragment51 HEK-293T C141(1.06); C270(1.06)  LDD1631  [10]
 LDCM0022  KB02 HEK-293T C409(1.04); C126(1.14); C270(0.91)  LDD1492  [10]
 LDCM0023  KB03 HEK-293T C409(1.01); C126(1.34); C270(1.12)  LDD1497  [10]
 LDCM0024  KB05 HMCB C162(1.40)  LDD3312  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3',5'-cyclic-AMP phosphodiesterase 4D (PDE4D) Cyclic nucleotide phosphodiesterase family Q08499
Heat shock cognate 71 kDa protein (HSPA8) Heat shock protein 70 family P11142
Protein phosphatase 1A (PPM1A) PP2C family P35813
Protein phosphatase 1B (PPM1B) PP2C family O75688
Serine/threonine-protein kinase 38 (STK38) AGC Ser/Thr protein kinase family Q15208
Serine/threonine-protein kinase PRP4 homolog (PRPF4B) CMGC Ser/Thr protein kinase family Q13523
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Mitogen-activated protein kinase kinase kinase 5 (MAP3K5) STE Ser/Thr protein kinase family Q99683
Proto-oncogene tyrosine-protein kinase Src (SRC) Tyr protein kinase family P12931
Pyruvate kinase PKM (PKM) Pyruvate kinase family P14618
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein theta (YWHAQ) 14-3-3 family P27348
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Beta-2 adrenergic receptor (ADRB2) G-protein coupled receptor 1 family P07550
Endothelin-1 receptor (EDNRA) G-protein coupled receptor 1 family P25101
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleolar and coiled-body phosphoprotein 1 (NOLC1) NOLC1 family Q14978
Protein S100-A9 (S100A9) S-100 family P06702
Gelsolin (GSN) Villin/gelsolin family P06396
Zinc finger Ran-binding domain-containing protein 2 (ZRANB2) ZRANB2 family O95218
Nucleolin (NCL) . P19338
Treacle protein (TCOF1) . Q13428

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
9 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
10 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402