Details of the Target

General Information of Target

Target ID LDTP03453
Target Name Progranulin (GRN)
Gene Name GRN
Gene ID 2896
Synonyms
Progranulin; PGRN; Acrogranin; Epithelin precursor; Glycoprotein of 88 Kda; GP88; Glycoprotein 88; Granulin precursor; PC cell-derived growth factor; PCDGF; Proepithelin; PEPI) [Cleaved into: Paragranulin; Granulin-1; Granulin G; Granulin-2; Granulin F; Granulin-3; Epithelin-2; Granulin B; Granulin-4; Epithelin-1; Granulin A; Granulin-5; Granulin C; Granulin-6; Granulin D; Granulin-7; Granulin E)]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGP
CQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNS
VGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIT
PTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCC
SDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQ
SGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
KRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQH
CCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQG
WACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Target Type
Clinical trial
Target Bioclass
Other
Family
Granulin family
Subcellular location
Secreted
Function
Secreted protein that acts as a key regulator of lysosomal function and as a growth factor involved in inflammation, wound healing and cell proliferation. Regulates protein trafficking to lysosomes and, also the activity of lysosomal enzymes. Facilitates also the acidification of lysosomes, causing degradation of mature CTSD by CTSB. In addition, functions as a wound-related growth factor that acts directly on dermal fibroblasts and endothelial cells to promote division, migration and the formation of capillary-like tubule structures. Also promotes epithelial cell proliferation by blocking TNF-mediated neutrophil activation preventing release of oxidants and proteases. Moreover, modulates inflammation in neurons by preserving neurons survival, axonal outgrowth and neuronal integrity.; [Granulin-4]: Promotes proliferation of the epithelial cell line A431 in culture.; [Granulin-3]: Inhibits epithelial cell proliferation and induces epithelial cells to secrete IL-8.; [Granulin-7]: Stabilizes CTSD through interaction with CTSD leading to maintain its aspartic-type peptidase activity.
TTD ID
T45182
Uniprot ID
P28799
DrugMap ID
TT4LM0E
Ensemble ID
ENST00000053867.8
HGNC ID
HGNC:4601

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
Ishikawa (Heraklio) 02 ER SNV: p.R43C .
KMS11 SNV: p.D144Y .
MFE319 SNV: p.A69V .
SW1573 SNV: p.N118S .
TOV21G SNV: p.F25L DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 10 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		12.70  LDD0402  [1]
Alkylaryl probe 1
 Probe Info  		20.00  LDD0387  [2]
STPyne
 Probe Info  		K189(9.20)  LDD0277  [3]
Acrolein
 Probe Info  		H167(0.00); H557(0.00)  LDD0221  [4]
DBIA
 Probe Info  		C164(0.86); C165(0.86); C171(0.86)  LDD0078  [5]
5E-2FA
 Probe Info  		H351(0.00); H185(0.00); H104(0.00)  LDD2235  [6]
IA-alkyne
 Probe Info  		C105(0.00); C558(0.00); C208(0.00); C178(0.00)  LDD0162  [7]
TFBX
 Probe Info  		N.A.  LDD0027  [8]
AOyne
 Probe Info  		14.10  LDD0443  [9]
NAIA_5
 Probe Info  		C208(0.00); C178(0.00); C105(0.00)  LDD2223  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C164(1.04)  LDD1508  [11]
 LDCM0226  AC11 HEK-293T C178(1.18)  LDD1509  [11]
 LDCM0237  AC12 HEK-293T C178(1.07)  LDD1510  [11]
 LDCM0259  AC14 HEK-293T C208(1.04); C165(1.08)  LDD1512  [11]
 LDCM0270  AC15 HEK-293T C165(0.99)  LDD1513  [11]
 LDCM0277  AC18 HEK-293T C164(0.96)  LDD1516  [11]
 LDCM0278  AC19 HEK-293T C178(1.06)  LDD1517  [11]
 LDCM0279  AC2 HEK-293T C164(1.10)  LDD1518  [11]
 LDCM0280  AC20 HEK-293T C178(1.07)  LDD1519  [11]
 LDCM0281  AC21 HEK-293T C165(0.94)  LDD1520  [11]
 LDCM0282  AC22 HEK-293T C208(0.90); C165(1.09)  LDD1521  [11]
 LDCM0283  AC23 HEK-293T C165(0.79)  LDD1522  [11]
 LDCM0284  AC24 HEK-293T C165(1.01)  LDD1523  [11]
 LDCM0286  AC26 HEK-293T C164(0.94)  LDD1525  [11]
 LDCM0287  AC27 HEK-293T C178(1.02)  LDD1526  [11]
 LDCM0288  AC28 HEK-293T C178(1.01)  LDD1527  [11]
 LDCM0289  AC29 HEK-293T C165(1.15)  LDD1528  [11]
 LDCM0290  AC3 HEK-293T C178(1.14)  LDD1529  [11]
 LDCM0291  AC30 HEK-293T C208(0.93); C165(1.05)  LDD1530  [11]
 LDCM0292  AC31 HEK-293T C165(0.78)  LDD1531  [11]
 LDCM0293  AC32 HEK-293T C165(0.92)  LDD1532  [11]
 LDCM0295  AC34 HEK-293T C164(1.15)  LDD1534  [11]
 LDCM0296  AC35 HEK-293T C178(1.13)  LDD1535  [11]
 LDCM0297  AC36 HEK-293T C178(1.07)  LDD1536  [11]
 LDCM0298  AC37 HEK-293T C165(1.20)  LDD1537  [11]
 LDCM0299  AC38 HEK-293T C208(0.95); C165(1.04)  LDD1538  [11]
 LDCM0300  AC39 HEK-293T C165(0.82)  LDD1539  [11]
 LDCM0301  AC4 HEK-293T C178(1.03)  LDD1540  [11]
 LDCM0302  AC40 HEK-293T C165(0.89)  LDD1541  [11]
 LDCM0304  AC42 HEK-293T C164(0.95)  LDD1543  [11]
 LDCM0305  AC43 HEK-293T C178(1.10)  LDD1544  [11]
 LDCM0306  AC44 HEK-293T C178(1.08)  LDD1545  [11]
 LDCM0307  AC45 HEK-293T C165(0.90)  LDD1546  [11]
 LDCM0308  AC46 HEK-293T C208(0.94); C165(1.17)  LDD1547  [11]
 LDCM0309  AC47 HEK-293T C165(0.77)  LDD1548  [11]
 LDCM0310  AC48 HEK-293T C165(1.02)  LDD1549  [11]
 LDCM0312  AC5 HEK-293T C165(1.11)  LDD1551  [11]
 LDCM0313  AC50 HEK-293T C164(1.08)  LDD1552  [11]
 LDCM0314  AC51 HEK-293T C178(1.09)  LDD1553  [11]
 LDCM0315  AC52 HEK-293T C178(1.05)  LDD1554  [11]
 LDCM0316  AC53 HEK-293T C165(0.97)  LDD1555  [11]
 LDCM0317  AC54 HEK-293T C208(0.83); C165(1.00)  LDD1556  [11]
 LDCM0318  AC55 HEK-293T C165(0.81)  LDD1557  [11]
 LDCM0319  AC56 HEK-293T C165(1.01)  LDD1558  [11]
 LDCM0321  AC58 HEK-293T C164(0.95)  LDD1560  [11]
 LDCM0322  AC59 HEK-293T C178(1.17)  LDD1561  [11]
 LDCM0323  AC6 HEK-293T C208(0.99); C165(1.08)  LDD1562  [11]
 LDCM0324  AC60 HEK-293T C178(1.16)  LDD1563  [11]
 LDCM0325  AC61 HEK-293T C165(0.94)  LDD1564  [11]
 LDCM0326  AC62 HEK-293T C208(0.96); C165(0.91)  LDD1565  [11]
 LDCM0327  AC63 HEK-293T C165(1.15)  LDD1566  [11]
 LDCM0328  AC64 HEK-293T C165(0.88)  LDD1567  [11]
 LDCM0334  AC7 HEK-293T C165(0.86)  LDD1568  [11]
 LDCM0345  AC8 HEK-293T C165(0.95)  LDD1569  [11]
 LDCM0248  AKOS034007472 HEK-293T C165(0.86)  LDD1511  [11]
 LDCM0275  AKOS034007705 HEK-293T C165(0.94)  LDD1514  [11]
 LDCM0020  ARS-1620 HCC44 C164(0.86); C165(0.86); C171(0.86)  LDD0078  [5]
 LDCM0108  Chloroacetamide HeLa H167(0.00); H175(0.00); H557(0.00)  LDD0222  [4]
 LDCM0368  CL10 HEK-293T C208(1.38); C165(0.97)  LDD1572  [11]
 LDCM0379  CL11 HEK-293T C165(0.93)  LDD1583  [11]
 LDCM0390  CL12 HEK-293T C165(0.88)  LDD1594  [11]
 LDCM0405  CL18 HEK-293T C164(1.03)  LDD1609  [11]
 LDCM0406  CL19 HEK-293T C178(1.10)  LDD1610  [11]
 LDCM0408  CL20 HEK-293T C178(1.08)  LDD1612  [11]
 LDCM0409  CL21 HEK-293T C165(1.34)  LDD1613  [11]
 LDCM0410  CL22 HEK-293T C208(1.41); C165(1.03)  LDD1614  [11]
 LDCM0411  CL23 HEK-293T C165(0.93)  LDD1615  [11]
 LDCM0412  CL24 HEK-293T C165(0.80)  LDD1616  [11]
 LDCM0419  CL30 HEK-293T C164(1.20)  LDD1623  [11]
 LDCM0420  CL31 HEK-293T C178(1.14)  LDD1624  [11]
 LDCM0421  CL32 HEK-293T C178(1.03)  LDD1625  [11]
 LDCM0422  CL33 HEK-293T C165(1.16)  LDD1626  [11]
 LDCM0423  CL34 HEK-293T C208(1.52); C165(0.98)  LDD1627  [11]
 LDCM0424  CL35 HEK-293T C165(0.84)  LDD1628  [11]
 LDCM0425  CL36 HEK-293T C165(1.17)  LDD1629  [11]
 LDCM0432  CL42 HEK-293T C164(1.12)  LDD1636  [11]
 LDCM0433  CL43 HEK-293T C178(1.07)  LDD1637  [11]
 LDCM0434  CL44 HEK-293T C178(1.08)  LDD1638  [11]
 LDCM0435  CL45 HEK-293T C165(0.96)  LDD1639  [11]
 LDCM0436  CL46 HEK-293T C208(1.53); C165(1.02)  LDD1640  [11]
 LDCM0437  CL47 HEK-293T C165(0.86)  LDD1641  [11]
 LDCM0438  CL48 HEK-293T C165(1.01)  LDD1642  [11]
 LDCM0445  CL54 HEK-293T C164(1.03)  LDD1648  [11]
 LDCM0446  CL55 HEK-293T C178(1.13)  LDD1649  [11]
 LDCM0447  CL56 HEK-293T C178(1.16)  LDD1650  [11]
 LDCM0448  CL57 HEK-293T C165(1.37)  LDD1651  [11]
 LDCM0449  CL58 HEK-293T C208(1.61); C165(1.09)  LDD1652  [11]
 LDCM0450  CL59 HEK-293T C165(0.98)  LDD1653  [11]
 LDCM0451  CL6 HEK-293T C164(0.96)  LDD1654  [11]
 LDCM0452  CL60 HEK-293T C165(0.85)  LDD1655  [11]
 LDCM0458  CL66 HEK-293T C164(0.97)  LDD1661  [11]
 LDCM0459  CL67 HEK-293T C178(1.24)  LDD1662  [11]
 LDCM0460  CL68 HEK-293T C178(1.07)  LDD1663  [11]
 LDCM0461  CL69 HEK-293T C165(1.08)  LDD1664  [11]
 LDCM0462  CL7 HEK-293T C178(1.14)  LDD1665  [11]
 LDCM0463  CL70 HEK-293T C208(1.36); C165(0.99)  LDD1666  [11]
 LDCM0464  CL71 HEK-293T C165(0.96)  LDD1667  [11]
 LDCM0465  CL72 HEK-293T C165(1.11)  LDD1668  [11]
 LDCM0471  CL78 HEK-293T C164(1.02)  LDD1674  [11]
 LDCM0472  CL79 HEK-293T C178(1.12)  LDD1675  [11]
 LDCM0473  CL8 HEK-293T C178(1.29)  LDD1676  [11]
 LDCM0474  CL80 HEK-293T C178(1.12)  LDD1677  [11]
 LDCM0475  CL81 HEK-293T C165(1.04)  LDD1678  [11]
 LDCM0476  CL82 HEK-293T C208(1.42); C165(1.02)  LDD1679  [11]
 LDCM0477  CL83 HEK-293T C165(0.80)  LDD1680  [11]
 LDCM0478  CL84 HEK-293T C165(0.89)  LDD1681  [11]
 LDCM0484  CL9 HEK-293T C165(1.10)  LDD1687  [11]
 LDCM0485  CL90 HEK-293T C164(0.94)  LDD1688  [11]
 LDCM0486  CL91 HEK-293T C178(1.14)  LDD1689  [11]
 LDCM0487  CL92 HEK-293T C178(1.12)  LDD1690  [11]
 LDCM0488  CL93 HEK-293T C165(1.17)  LDD1691  [11]
 LDCM0489  CL94 HEK-293T C208(1.18); C165(1.04)  LDD1692  [11]
 LDCM0490  CL95 HEK-293T C165(0.94)  LDD1693  [11]
 LDCM0491  CL96 HEK-293T C165(1.29)  LDD1694  [11]
 LDCM0107  IAA HeLa H167(0.00); H557(0.00)  LDD0221  [4]
 LDCM0022  KB02 HEK-293T C208(0.99)  LDD1492  [11]
 LDCM0023  KB03 HEK-293T C208(1.37)  LDD1497  [11]
 LDCM0024  KB05 OCUG-1 C178(1.57)  LDD3373  [12]
 LDCM0109  NEM HeLa N.A.  LDD0223  [4]
 LDCM0021  THZ1 HCT 116 C481(1.11); C482(1.11); C488(1.11)  LDD2173  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 49 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
GTP:AMP phosphotransferase AK3, mitochondrial (AK3) Adenylate kinase family Q9UIJ7
tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial (TRMT61B) TRM61 family Q9BVS5
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Tyrosine aminotransferase (TAT) Class-I pyridoxal-phosphate-dependent aminotransferase family P17735
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
Cytochrome b5 (CYB5A) Cytochrome b5 family P00167
Cryptochrome-2 (CRY2) DNA photolyase class-1 family Q49AN0
Deoxyribonuclease-1-like 1 (DNASE1L1) DNase I family P49184
DNA-directed RNA polymerase III subunit RPC6 (POLR3F) Eukaryotic RPC34/RPC39 RNA polymerase subunit family Q9H1D9
Serine protease FAM111B (FAM111B) FAM111 family Q6SJ93
FAST kinase domain-containing protein 1, mitochondrial (FASTKD1) FAST kinase family Q53R41
Glucose-fructose oxidoreductase domain-containing protein 1 (GFOD1) Gfo/Idh/MocA family Q9NXC2
F-box DNA helicase 1 (FBH1) Helicase family Q8NFZ0
Phosphatidate phosphatase LPIN1 (LPIN1) Lipin family Q14693
Lysyl oxidase homolog 4 (LOXL4) Lysyl oxidase family Q96JB6
Dihydropyrimidinase-related protein 4 (DPYSL4) Hydantoinase/dihydropyrimidinase family O14531
Peptidoglycan recognition protein 3 (PGLYRP3) N-acetylmuramoyl-L-alanine amidase 2 family Q96LB9
Transcriptional repressor NF-X1 (NFX1) NFX1 family Q12986
Phospholipid phosphatase-related protein type 1 (PLPPR1) PA-phosphatase related phosphoesterase family Q8TBJ4
Cathepsin D (CTSD) Peptidase A1 family P07339
Calpain-15 (CAPN15) Peptidase C2 family O75808
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
ATP-dependent Clp protease proteolytic subunit, mitochondrial (CLPP) Peptidase S14 family Q16740
Proteasome subunit beta type-10 (PSMB10) Peptidase T1B family P40306
Group XIIA secretory phospholipase A2 (PLA2G12A) Phospholipase A2 family Q9BZM1
E3 SUMO-protein ligase PIAS1 (PIAS1) PIAS family O75925
Protein disulfide-isomerase (P4HB) Protein disulfide isomerase family P07237
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G) CAMK Ser/Thr protein kinase family Q96NX5
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Serine/threonine-protein kinase NLK (NLK) CMGC Ser/Thr protein kinase family Q9UBE8
Mitogen-activated protein kinase kinase kinase 5 (MAP3K5) STE Ser/Thr protein kinase family Q99683
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1) Protein-tyrosine phosphatase family Q8WUK0
E3 ubiquitin-protein ligase RNF14 (RNF14) RBR family Q9UBS8
Ribose-phosphate pyrophosphokinase 2 (PRPS2) Ribose-phosphate pyrophosphokinase family P11908
Anaphase-promoting complex subunit 11 (ANAPC11) RING-box family Q9NYG5
NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3) Sirtuin family Q9NTG7
SPRY domain-containing SOCS box protein 3 (SPSB3) SPSB family Q6PJ21
Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2) Sulfatase-modifying factor family Q8NBJ7
RING finger protein 112 (RNF112) GB1/RHD3 GTPase family Q9ULX5
Kinesin-like protein KIF1A (KIF1A) Kinesin family Q12756
Septin-6 (SEPTIN6) Septin GTPase family Q14141
G/T mismatch-specific thymine DNA glycosylase (TDG) TDG/mug family Q13569
E3 ubiquitin-protein ligase CHIP (STUB1) . Q9UNE7
E3 ubiquitin-protein ligase FANCL (FANCL) . Q9NW38
E3 ubiquitin-protein ligase RNF138 (RNF138) . Q8WVD3
Eukaryotic translation initiation factor 5B (EIF5B) . O60841
Glutaredoxin-3 (GLRX3) . O76003
RING finger protein 208 (RNF208) . Q9H0X6
Transporter and channel
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATPase inhibitor, mitochondrial (ATP5IF1) ATPase inhibitor family Q9UII2
Bcl-2 homologous antagonist/killer (BAK1) Bcl-2 family Q16611
Beclin-1 (BECN1) Beclin family Q14457
Voltage-dependent P/Q-type calcium channel subunit alpha-1A (CACNA1A) Calcium channel alpha-1 subunit (TC 1.A.1.11) family O00555
Voltage-dependent anion-selective channel protein 2 (VDAC2) Eukaryotic mitochondrial porin family P45880
Secretory carrier-associated membrane protein 4 (SCAMP4) SCAMP family Q969E2
Serine incorporator 3 (SERINC3) TDE1 family Q13530
Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) Tim17/Tim22/Tim23 family O60830
p53 apoptosis effector related to PMP-22 (PERP) TMEM47 family Q96FX8
Sortilin (SORT1) VPS10-related sortilin family Q99523
Prosaposin (PSAP) . P07602
Uncharacterized protein CXorf38 (CXorf38) . Q8TB03
Transcription factor
Click To Hide/Show 41 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C4 (HOXC4) Antp homeobox family P09017
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Homeobox protein DLX-2 (DLX2) Distal-less homeobox family Q07687
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Krueppel-like factor 3 (KLF3) Krueppel C2H2-type zinc-finger protein family P57682
Myoneurin (MYNN) Krueppel C2H2-type zinc-finger protein family Q9NPC7
Zinc finger and SCAN domain-containing protein 9 (ZSCAN9) Krueppel C2H2-type zinc-finger protein family O15535
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 138 (ZNF138) Krueppel C2H2-type zinc-finger protein family P52744
Zinc finger protein 239 (ZNF239) Krueppel C2H2-type zinc-finger protein family Q16600
Zinc finger protein 296 (ZNF296) Krueppel C2H2-type zinc-finger protein family Q8WUU4
Zinc finger protein 497 (ZNF497) Krueppel C2H2-type zinc-finger protein family Q6ZNH5
Zinc finger protein 524 (ZNF524) Krueppel C2H2-type zinc-finger protein family Q96C55
Zinc finger protein 57 (ZNF57) Krueppel C2H2-type zinc-finger protein family Q68EA5
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 64 (ZFP64) Krueppel C2H2-type zinc-finger protein family Q9NTW7
Zinc finger protein 670 (ZNF670) Krueppel C2H2-type zinc-finger protein family Q9BS34
Zinc finger protein 696 (ZNF696) Krueppel C2H2-type zinc-finger protein family Q9H7X3
Zinc finger protein 697 (ZNF697) Krueppel C2H2-type zinc-finger protein family Q5TEC3
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein 791 (ZNF791) Krueppel C2H2-type zinc-finger protein family Q3KP31
Zinc finger protein GLI4 (GLI4) Krueppel C2H2-type zinc-finger protein family P10075
Zinc finger protein with KRAB and SCAN domains 8 (ZKSCAN8) Krueppel C2H2-type zinc-finger protein family Q15776
NAC-alpha domain-containing protein 1 (NACAD) NAC-alpha family O15069
Nuclear receptor subfamily 1 group D member 2 (NR1D2) Nuclear hormone receptor family Q14995
Visual system homeobox 2 (VSX2) Paired homeobox family P58304
Homeobox protein OTX1 (OTX1) Paired homeobox family P32242
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
Krueppel-like factor 15 (KLF15) Sp1 C2H2-type zinc-finger protein family Q9UIH9
TATA box-binding protein-like 1 (TBPL1) TBP family P62380
TSC22 domain family protein 4 (TSC22D4) TSC-22/Dip/Bun family Q9Y3Q8
Transcriptional repressor protein YY1 (YY1) YY transcription factor family P25490
Achaete-scute homolog 4 (ASCL4) . Q6XD76
Hematopoietically-expressed homeobox protein HHEX (HHEX) . Q03014
LIM/homeobox protein Lhx6 (LHX6) . Q9UPM6
LIM/homeobox protein Lhx8 (LHX8) . Q68G74
Myeloid cell nuclear differentiation antigen (MNDA) . P41218
Transcription factor SOX-14 (SOX14) . O95416
Zinc finger and SCAN domain-containing protein 26 (ZSCAN26) . Q16670
Zinc finger homeobox protein 2 (ZFHX2) . Q9C0A1
Zinc finger protein 366 (ZNF366) . Q8N895
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
P2Y purinoceptor 6 (P2RY6) G-protein coupled receptor 1 family Q15077
Probable G-protein coupled receptor 141 (GPR141) G-protein coupled receptor 1 family Q7Z602
Cytokine and receptor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-X-C motif chemokine 5 (CXCL5) Intercrine alpha (chemokine CxC) family P42830
Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) . P19438
Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B) . P20333
Other
Click To Hide/Show 115 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) ATG8 family Q9GZQ8
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
Protein BRICK1 (BRK1) BRK1 family Q8WUW1
Fatty acid-binding protein, brain (FABP7) Fatty-acid binding protein (FABP) family O15540
Protein canopy homolog 3 (CNPY3) Canopy family Q9BT09
Cbp/p300-interacting transactivator 2 (CITED2) CITED family Q99967
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Cystatin-A (CSTA) Cystatin family P01040
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
26S proteasome complex subunit SEM1 (SEM1) DSS1/SEM1 family P60896
Epidermal growth factor receptor kinase substrate 8-like protein 2 (EPS8L2) EPS8 family Q9H6S3
Protein FAM131C (FAM131C) FAM131 family Q96AQ9
Protein FAM74A4/A6 (FAM74A4; FAM74A6) FAM74 family Q5TZK3
Protein FAM9A (FAM9A) FAM9 family Q8IZU1
Protein FAM98C (FAM98C) FAM98 family Q17RN3
Fibulin-5 (FBLN5) Fibulin family Q9UBX5
Putative golgin subfamily A member 2B (GOLGA2P5) GOLGA2 family Q9HBQ8
Iron-sulfur cluster assembly 2 homolog, mitochondrial (ISCA2) HesB/IscA family Q86U28
Histone H3.1 (H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3C10; H3C11; H3C12) Histone H3 family P68431
Histone H3.3C (H3-5) Histone H3 family Q6NXT2
Inhibitor of growth protein 4 (ING4) ING family Q9UNL4
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Kelch-like ECH-associated protein 1 (KEAP1) KEAP1 family Q14145
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-5 (KRTAP1-5) KRTAP type 1 family Q9BYS1
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 12-1 (KRTAP12-1) KRTAP type 12 family P59990
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 5-9 (KRTAP5-9) KRTAP type 5 family P26371
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Lebercilin-like protein (LCA5L) LCA5 family O95447
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 1B (LCE1B) LCE family Q5T7P3
Late cornified envelope protein 1D (LCE1D) LCE family Q5T752
Late cornified envelope protein 1E (LCE1E) LCE family Q5T753
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Late cornified envelope protein 2B (LCE2B) LCE family O14633
Late cornified envelope protein 2D (LCE2D) LCE family Q5TA82
Late cornified envelope protein 3C (LCE3C) LCE family Q5T5A8
Late cornified envelope protein 3E (LCE3E) LCE family Q5T5B0
Late cornified envelope protein 4A (LCE4A) LCE family Q5TA78
Plasmolipin (PLLP) MAL family Q9Y342
Cytosolic iron-sulfur assembly component 2B (CIAO2B) MIP18 family Q9Y3D0
Protein Mis18-beta (OIP5) Mis18 family O43482
NADH dehydrogenase 1 alpha subcomplex assembly factor 4 (NDUFAF4) NDUFAF4 family Q9P032
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Keratin-associated protein 13-2 (KRTAP13-2) PMG family Q52LG2
Keratin-associated protein 13-3 (KRTAP13-3) PMG family Q3SY46
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
Rhophilin-1 (RHPN1) RHPN family Q8TCX5
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Protein sprouty homolog 2 (SPRY2) Sprouty family O43597
Protein sprouty homolog 4 (SPRY4) Sprouty family Q9C004
Syndecan-2 (SDC2) Syndecan proteoglycan family P34741
Protein TASOR 2 (TASOR2) TASOR family Q5VWN6
T-complex protein 10A homolog 1 (TCP10L) TCP10 family Q8TDR4
Tetraspanin-4 (TSPAN4) Tetraspanin (TM4SF) family O14817
Transcription elongation factor A protein-like 8 (TCEAL8) TFS-II family Q8IYN2
Small ribosomal subunit protein uS17m (MRPS17) Universal ribosomal protein uS17 family Q9Y2R5
Small ribosomal subunit protein uS8 (RPS15A) Universal ribosomal protein uS8 family P62244
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Synaptic plasticity regulator PANTS (C22orf39) UPF0545 family Q6P5X5
rRNA-processing protein UTP23 homolog (UTP23) UTP23/FCF1 family Q9BRU9
Vacuolar protein sorting-associated protein 37A (VPS37A) VPS37 family Q8NEZ2
Transducin-like enhancer protein 1 (TLE1) WD repeat Groucho/TLE family Q04724
Protein YIF1A (YIF1A) YIF1 family O95070
ADP-ribosylation factor GTPase-activating protein 1 (ARFGAP1) . Q8N6T3
C-type lectin domain family 11 member A (CLEC11A) . Q9Y240
CAP-Gly domain-containing linker protein 3 (CLIP3) . Q96DZ5
Chromatin complexes subunit BAP18 (BAP18) . Q8IXM2
Coiled-coil domain-containing protein 33 (CCDC33) . Q8N5R6
Cysteine-rich C-terminal protein 1 (CRCT1) . Q9UGL9
Drebrin (DBN1) . Q16643
Ephexin-1 (NGEF) . Q8N5V2
Extracellular matrix protein 1 (ECM1) . Q16610
F-box/WD repeat-containing protein 1A (BTRC) . Q9Y297
FAS-associated factor 1 (FAF1) . Q9UNN5
FMR1-interacting protein NUFIP2 (NUFIP2) . Q7Z417
G-protein-signaling modulator 3 (GPSM3) . Q9Y4H4
Huntingtin-interacting protein M (H2AP) . O75409
Insulin-like growth factor-binding protein 4 (IGFBP4) . P22692
IQ domain-containing protein F2 (IQCF2) . Q8IXL9
Kelch-like protein 20 (KLHL20) . Q9Y2M5
Myosin regulatory light chain 11 (MYL11) . Q96A32
Necdin (NDN) . Q99608
Period circadian protein homolog 1 (PER1) . O15534
PHD finger protein 7 (PHF7) . Q9BWX1
Pleckstrin homology domain-containing family G member 7 (PLEKHG7) . Q6ZR37
Protein delta homolog 1 (DLK1) . P80370
Pumilio homolog 1 (PUM1) . Q14671
Putative BPES syndrome breakpoint region protein (BPESC1) . Q9GZL8
Putative insulin-like growth factor 2-associated protein . P09565
Putative uncharacterized protein RUSC1-AS1 (RUSC1-AS1) . Q66K80
RING1 and YY1-binding protein (RYBP) . Q8N488
RNA-binding protein 14 (RBM14) . Q96PK6
Serine protease inhibitor Kazal-type 2 (SPINK2) . P20155
Sperm mitochondrial-associated cysteine-rich protein (SMCP) . P49901
Sperm-associated microtubule inner protein 4 (SPMIP4) . Q8N865
Spermatogenesis-associated protein 8 (SPATA8) . Q6RVD6
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Sprouty-related, EVH1 domain-containing protein 2 (SPRED2) . Q7Z698
Superkiller complex protein 8 (SKIC8) . Q9GZS3
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
Testis-expressed protein 19 (TEX19) . Q8NA77
Tetratricopeptide repeat protein 1 (TTC1) . Q99614
TP53-target gene 5 protein (TP53TG5) . Q9Y2B4
Transmembrane protein 61 (TMEM61) . Q8N0U2
U5 small nuclear ribonucleoprotein 40 kDa protein (SNRNP40) . Q96DI7
Uncharacterized protein C4orf17 (C4orf17) . Q53FE4
Uncharacterized protein C7orf50 (C7orf50) . Q9BRJ6
Vasorin (VASN) . Q6EMK4

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Hydrazines as versatile chemical biology probes and drug-discovery tools for cofactor-dependent enzymes. bioRxiv, 2020-06.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
6 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
9 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
10 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
11 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
12 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840