Details of the Target
General Information of Target
| Target ID | LDTP02843 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H1.5 (H1-5) | |||||
| Gene Name | H1-5 | |||||
| Gene ID | 3009 | |||||
| Synonyms |
H1F5; HIST1H1B; Histone H1.5; Histone H1a; Histone H1b; Histone H1s-3 |
|||||
| 3D Structure | ||||||
| Sequence |
MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGL
SLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAK PKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAA AKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H1/H5 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P2 Probe Info |
![]() |
1.70 | LDD0449 | [1] | |
|
P8 Probe Info |
![]() |
2.59 | LDD0451 | [1] | |
|
A-EBA Probe Info |
![]() |
4.24 | LDD0215 | [2] | |
|
AZ-9 Probe Info |
![]() |
E77(1.09); E8(1.83) | LDD2208 | [3] | |
|
ONAyne Probe Info |
![]() |
N.A. | LDD0273 | [4] | |
|
Probe 1 Probe Info |
![]() |
Y74(8.22) | LDD3495 | [5] | |
|
W1 Probe Info |
![]() |
K66(0.56) | LDD0237 | [6] | |
|
2PCA Probe Info |
![]() |
K88(0.00); K113(0.00); K66(0.00) | LDD0034 | [7] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [8] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [9] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References










