Details of the Target

General Information of Target

Target ID LDTP02308
Target Name Keratin, type I cytoskeletal 16 (KRT16)
Gene Name KRT16
Gene ID 3868
Synonyms
KRT16A; Keratin, type I cytoskeletal 16; Cytokeratin-16; CK-16; Keratin-16; K16
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGG
ACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVT
MQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIA
ATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQ
IEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN
RRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENS
LEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
Target Bioclass
Other
Family
Intermediate filament family
Function
Epidermis-specific type I keratin that plays a key role in skin. Acts as a regulator of innate immunity in response to skin barrier breach: required for some inflammatory checkpoint for the skin barrier maintenance.
Uniprot ID
P08779
Ensemble ID
ENST00000301653.9
HGNC ID
HGNC:6423

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P2
 Probe Info  		1.60  LDD0453  [1]
P8
 Probe Info  		10.00  LDD0451  [1]
8RK64
 Probe Info  		N.A.  LDD0039  [2]
YN-1
 Probe Info  		100.00  LDD0444  [3]
DBIA
 Probe Info  		C391(1.88); C18(3.99); C40(5.27)  LDD3321  [4]
Jackson_14
 Probe Info  		7.69  LDD0123  [5]
Johansson_61
 Probe Info  		_(20.00)  LDD1490  [6]
Lodoacetamide azide
 Probe Info  		C18(0.00); C40(0.00); C369(0.00)  LDD0037  [7]
IA-alkyne
 Probe Info  		N.A.  LDD0149  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0617  Fragment63-S Jurkat _(20.00)  LDD1490  [6]
 LDCM0022  KB02 8305C C18(1.49)  LDD2248  [4]
 LDCM0023  KB03 8505C C18(4.35); C40(4.97)  LDD2666  [4]
 LDCM0024  KB05 SH4 C391(1.88); C18(3.99); C40(5.27)  LDD3321  [4]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 7.69  LDD0123  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
tRNA pseudouridine synthase Pus10 (PUS10) Pseudouridine synthase Pus10 family Q3MIT2
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Semaphorin-4C (SEMA4C) Semaphorin family Q9C0C4
Other
Click To Hide/Show 37 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclin-C (CCNC) Cyclin family P24863
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 (GNG10) G protein gamma family P50151
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 5 (KRT5) Intermediate filament family P13647
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 74 (KRT74) Intermediate filament family Q7RTS7
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Peripherin (PRPH) Intermediate filament family P41219
Kinesin light chain 4 (KLC4) Kinesin light chain family Q9NSK0
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Arfaptin-2 (ARFIP2) . P53365
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Cytohesin-4 (CYTH4) . Q9UIA0
EPM2A-interacting protein 1 (EPM2AIP1) . Q7L775
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Phostensin (PPP1R18) . Q6NYC8
Rhombotin-1 (LMO1) . P25800

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Zinc . DB01593
Zinc Acetate . DB14487

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 Small-Molecule Activity-Based Probe for Monitoring Ubiquitin C-Terminal Hydrolase L1 (UCHL1) Activity in Live Cells and Zebrafish Embryos. J Am Chem Soc. 2020 Sep 30;142(39):16825-16841. doi: 10.1021/jacs.0c07726. Epub 2020 Sep 18.
Mass spectrometry data entry: PXD021557 , PXD015828
3 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
6 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
7 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
8 Sequence-Based Prediction of Cysteine Reactivity Using Machine Learning. Biochemistry. 2018 Jan 30;57(4):451-460. doi: 10.1021/acs.biochem.7b00897. Epub 2017 Oct 26.