Details of the Target
General Information of Target
| Target ID | LDTP14236 | |||||
|---|---|---|---|---|---|---|
| Target Name | Selenoprotein K (SELENOK) | |||||
| Gene Name | SELENOK | |||||
| Gene ID | 58515 | |||||
| Synonyms |
SELK; Selenoprotein K; SelK |
|||||
| 3D Structure | ||||||
| Sequence |
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQH
IASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHV IKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFA GLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLV SNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLK MLI |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Selenoprotein K family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration. Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins. Required for palmitoylation and cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation. Together with ZDHHC6, required for palmitoylation of ITPR1 in immune cells, leading to regulate ITPR1 stability and function. Plays a role in protection of cells from ER stress-induced apoptosis. Protects cells from oxidative stress when overexpressed in cardiomyocytes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
CCW36 Probe Info |
![]() |
3.73 | LDD2215 | [2] | |
|
Johansson_61 Probe Info |
![]() |
_(20.00) | LDD1485 | [3] | |
|
YY4-yne Probe Info |
![]() |
3.50 | LDD0400 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cannabinoid receptor 2 (CNR2) | G-protein coupled receptor 1 family | P34972 | |||
| Free fatty acid receptor 2 (FFAR2) | G-protein coupled receptor 1 family | O15552 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amphoterin-induced protein 1 (AMIGO1) | AMIGO family | Q86WK6 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-10 receptor subunit alpha (IL10RA) | Type II cytokine receptor family | Q13651 | |||
Other
References




