Details of the Target
General Information of Target
| Target ID | LDTP14164 | |||||
|---|---|---|---|---|---|---|
| Target Name | Immediate early response 3-interacting protein 1 (IER3IP1) | |||||
| Gene Name | IER3IP1 | |||||
| Gene ID | 51124 | |||||
| Synonyms |
Immediate early response 3-interacting protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
YOS1 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Regulator of endoplasmic reticulum secretion that acts as a key determinant of brain size. Required for secretion of extracellular matrix proteins. Required for correct brain development by depositing sufficient extracellular matrix proteins for tissue integrity and the proliferation of neural progenitors. Acts as a regulator of the unfolded protein response (UPR).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
8.31 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K49(6.05); K29(8.44) | LDD2217 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0232 | [3] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C094 Probe Info |
![]() |
30.27 | LDD1785 | [5] | |
|
C112 Probe Info |
![]() |
17.63 | LDD1799 | [5] | |
|
C293 Probe Info |
![]() |
17.75 | LDD1963 | [5] | |
|
C388 Probe Info |
![]() |
39.12 | LDD2047 | [5] | |
|
OEA-DA Probe Info |
![]() |
3.16 | LDD0046 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
GPCR
Other
References









