Details of the Target

General Information of Target

Target ID LDTP14164
Target Name Immediate early response 3-interacting protein 1 (IER3IP1)
Gene Name IER3IP1
Gene ID 51124
Synonyms
Immediate early response 3-interacting protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
Target Bioclass
Other
Family
YOS1 family
Subcellular location
Endoplasmic reticulum membrane
Function
Regulator of endoplasmic reticulum secretion that acts as a key determinant of brain size. Required for secretion of extracellular matrix proteins. Required for correct brain development by depositing sufficient extracellular matrix proteins for tissue integrity and the proliferation of neural progenitors. Acts as a regulator of the unfolded protein response (UPR).
Uniprot ID
Q9Y5U9
Ensemble ID
ENST00000256433.6
HGNC ID
HGNC:18550

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		8.31  LDD0402  [1]
STPyne
 Probe Info  		K49(6.05); K29(8.44)  LDD2217  [2]
Acrolein
 Probe Info  		N.A.  LDD0232  [3]
NAIA_5
 Probe Info  		N.A.  LDD2223  [4]
PAL-AfBPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C094
 Probe Info  		30.27  LDD1785  [5]
C112
 Probe Info  		17.63  LDD1799  [5]
C293
 Probe Info  		17.75  LDD1963  [5]
C388
 Probe Info  		39.12  LDD2047  [5]
OEA-DA
 Probe Info  		3.16  LDD0046  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 11.43  LDD0403  [1]
 LDCM0109  NEM HeLa N.A.  LDD0232  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT) CDP-alcohol phosphatidyltransferase class-I family O14735
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Transmembrane protein with metallophosphoesterase domain (TMPPE) LOC643853 family Q6ZT21
Endoplasmic reticulum metallopeptidase 1 (ERMP1) Peptidase M28 family Q7Z2K6
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) PIGP family P57054
Protein O-mannose kinase (POMK) Ser/Thr protein kinase family Q9H5K3
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
Ceramide synthase 2 (CERS2) . Q96G23
Ceramide synthase 4 (CERS4) . Q9HA82
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable proton-coupled zinc antiporter SLC30A4 (SLC30A4) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family O14863
Gap junction beta-1 protein (GJB1) Connexin family P08034
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
Transmembrane protein 258 (TMEM258) OST5 family P61165
Peroxisome assembly protein 12 (PEX12) Pex2/pex10/pex12 family O00623
Potassium voltage-gated channel subfamily A member 1 (KCNA1) Potassium channel family Q09470
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Transmembrane protein 14A (TMEM14A) TMEM14 family Q9Y6G1
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Protrudin (ZFYVE27) . Q5T4F4
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Thyrotropin-releasing hormone receptor (TRHR) G-protein coupled receptor 1 family P34981
Other
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cystatin-SN (CST1) Cystatin family P01037
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
Golgi SNAP receptor complex member 2 (GOSR2) GOSR2 family O14653
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Protein kish-A (TMEM167A) KISH family Q8TBQ9
Protein YIPF4 (YIPF4) YIP1 family Q9BSR8
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (HERPUD2) . Q9BSE4
Motile sperm domain-containing protein 3 (MOSPD3) . O75425
Transmembrane protein 80 (TMEM80) . Q96HE8
Ubiquilin-1 (UBQLN1) . Q9UMX0
Uncharacterized protein C19orf18 (C19orf18) . Q8NEA5

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
6 Mapping Protein Targets of Bioactive Small Molecules Using Lipid-Based Chemical Proteomics. ACS Chem Biol. 2017 Oct 20;12(10):2671-2681. doi: 10.1021/acschembio.7b00581. Epub 2017 Sep 20.
Mass spectrometry data entry: PXD007570