Details of the Target
General Information of Target
Target ID | LDTP10216 | |||||
---|---|---|---|---|---|---|
Target Name | RNA-binding protein Musashi homolog 2 (MSI2) | |||||
Gene Name | MSI2 | |||||
Gene ID | 124540 | |||||
Synonyms |
RNA-binding protein Musashi homolog 2; Musashi-2 |
|||||
3D Structure | ||||||
Sequence |
MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTR
YIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQ CHAQKIGIVGFCWGGTAVHHLMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDV VIPLKDVSLLTQKLKEHCKVEYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEW LNKYM |
|||||
Target Type |
Discontinued
|
|||||
Target Bioclass |
Other
|
|||||
Family |
Musashi family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function | RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system. | |||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
CCK81 | SNV: p.H171R | DBIA Probe Info | |||
FADU | SNV: p.E174K | . | |||
HT115 | SNV: p.F24C | DBIA Probe Info | |||
KMCH1 | SNV: p.S236T | . | |||
REH | SNV: p.R201Q | DBIA Probe Info |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TH211 Probe Info |
![]() |
Y40(16.85) | LDD0257 | [1] | |
DBIA Probe Info |
![]() |
C64(1.24) | LDD3310 | [2] | |
HPAP Probe Info |
![]() |
3.53 | LDD0062 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [4] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [5] | |
m-APA Probe Info |
![]() |
H171(0.00); H83(0.00) | LDD2231 | [5] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [6] | |
IPIAA_H Probe Info |
![]() |
N.A. | LDD0030 | [7] | |
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [7] | |
BTD Probe Info |
![]() |
N.A. | LDD0004 | [8] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C092 Probe Info |
![]() |
18.00 | LDD1783 | [10] | |
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [11] | |
FFF probe13 Probe Info |
![]() |
20.00 | LDD0475 | [11] | |
FFF probe2 Probe Info |
![]() |
20.00 | LDD0463 | [11] | |
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [11] | |
JN0003 Probe Info |
![]() |
20.00 | LDD0469 | [11] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Homeobox protein MOX-2 (MEOX2) | . | P50222 |
Other
References