Details of the Target
General Information of Target
| Target ID | LDTP10216 | |||||
|---|---|---|---|---|---|---|
| Target Name | RNA-binding protein Musashi homolog 2 (MSI2) | |||||
| Gene Name | MSI2 | |||||
| Gene ID | 124540 | |||||
| Synonyms |
RNA-binding protein Musashi homolog 2; Musashi-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTR
YIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQ CHAQKIGIVGFCWGGTAVHHLMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDV VIPLKDVSLLTQKLKEHCKVEYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEW LNKYM |
|||||
| Target Type |
Discontinued
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Musashi family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CCK81 | SNV: p.H171R | DBIA Probe Info | |||
| FADU | SNV: p.E174K | . | |||
| HT115 | SNV: p.F24C | DBIA Probe Info | |||
| KMCH1 | SNV: p.S236T | . | |||
| REH | SNV: p.R201Q | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y40(16.85) | LDD0257 | [1] | |
|
DBIA Probe Info |
![]() |
C64(1.24) | LDD3310 | [2] | |
|
HPAP Probe Info |
![]() |
3.53 | LDD0062 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [4] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [5] | |
|
m-APA Probe Info |
![]() |
H171(0.00); H83(0.00) | LDD2231 | [5] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [6] | |
|
IPIAA_H Probe Info |
![]() |
N.A. | LDD0030 | [7] | |
|
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [7] | |
|
BTD Probe Info |
![]() |
N.A. | LDD0004 | [8] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [9] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C092 Probe Info |
![]() |
18.00 | LDD1783 | [10] | |
|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0471 | [11] | |
|
FFF probe13 Probe Info |
![]() |
20.00 | LDD0475 | [11] | |
|
FFF probe2 Probe Info |
![]() |
20.00 | LDD0463 | [11] | |
|
FFF probe3 Probe Info |
![]() |
20.00 | LDD0464 | [11] | |
|
JN0003 Probe Info |
![]() |
20.00 | LDD0469 | [11] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein MOX-2 (MEOX2) | . | P50222 | |||
Other
References

















