Details of the Target
General Information of Target
Target ID | LDTP09108 | |||||
---|---|---|---|---|---|---|
Target Name | Mitoregulin (MTLN) | |||||
Gene Name | MTLN | |||||
Synonyms |
LEMP; LINC00116; MOXI; MPM; NCRNA00116; SMIM37; Mitoregulin; Micropeptide in mitochondria; Micropeptide regulator of beta-oxidation; Small integral membrane protein 37; lncRNA-encoded micropeptide |
|||||
3D Structure | ||||||
Sequence |
MADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA
|
|||||
Target Bioclass |
Other
|
|||||
Family |
Mitoregulin family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Positively regulates mitochondrial complex assembly and/or stability. Increases mitochondrial membrane potential while decreasing mitochondrial reactive oxygen species. Increases mitochondrial respiration rate. Increased mitochondrial respiratory activity promotes myogenic differentiation which facilitates muscle growth and regeneration. Increases mitochondrial calcium retention capacity. Plays a role in maintenance of cellular lipid composition through its interaction with cytochrome b5 reductase CYB5R3 which is required for mitochondrial respiratory complex I activity. Interacts with the mitochondrial trifunctional enzyme complex (MTE) and enhances fatty acid beta-oxidation. Not required for MTE formation or stability. Modulates triglyceride clearance in adipocytes through its role in regulating fatty acid beta-oxidation and lipolysis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K45(2.96) | LDD0274 | [1] | |
STPyne Probe Info |
![]() |
K45(8.79); K51(3.74) | LDD0277 | [1] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C091 Probe Info |
![]() |
16.56 | LDD1782 | [2] | |
C092 Probe Info |
![]() |
20.82 | LDD1783 | [2] | |
C094 Probe Info |
![]() |
27.28 | LDD1785 | [2] |
References