Details of the Target
General Information of Target
Target ID | LDTP08509 | |||||
---|---|---|---|---|---|---|
Target Name | FUN14 domain-containing protein 1 (FUNDC1) | |||||
Gene Name | FUNDC1 | |||||
Gene ID | 139341 | |||||
Synonyms |
FUN14 domain-containing protein 1 |
|||||
3D Structure | ||||||
Sequence |
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVT
GWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS |
|||||
Target Bioclass |
Other
|
|||||
Family |
FUN14 family
|
|||||
Subcellular location |
Mitochondrion outer membrane
|
|||||
Function |
Integral mitochondrial outer-membrane protein that mediates the formation of mitochondria-associated endoplasmic reticulum membranes (MAMs). In turn, mediates angiogenesis and neoangiogenesis through interference with intracellular Ca(2+) communication and regulation of the vascular endothelial growth factor receptor KDR/VEGFR2 expression at both mRNA and protein levels. Acts also as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality and homeostasis, by interacting with and recruiting LC3 protein family to mitochondria. Mechanistically, recruits DRP1 at ER-mitochondria contact sites leading to DRP1 oligomerization and GTPase activity to facilitate mitochondrial fission during hypoxia. Additionally, plays a role in hepatic ferroptosis by interacting directly with glutathione peroxidase/GPX4 to facilitate its recruitment into mitochondria through TOM/TIM complex where it is degraded by mitophagy.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C055 Probe Info |
![]() |
13.18 | LDD1752 | [1] | |
C056 Probe Info |
![]() |
20.53 | LDD1753 | [1] | |
BD-F Probe Info |
![]() |
E130(0.00); N125(0.00) | LDD0024 | [2] | |
LD-F Probe Info |
![]() |
N125(0.00); E130(0.00); I124(0.00) | LDD0015 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Other
References