Details of the Target

General Information of Target

Target ID LDTP05507
Target Name Cyclin-dependent kinase 18 (CDK18)
Gene Name CDK18
Gene ID 5129
Synonyms
PCTAIRE3; PCTK3; Cyclin-dependent kinase 18; EC 2.7.11.22; Cell division protein kinase 18; PCTAIRE-motif protein kinase 3; Serine/threonine-protein kinase PCTAIRE-3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECST
FSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDL
PKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHE
EGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMH
NVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNE
VVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTP
TEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAAL
SHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Target Type
Literature-reported
Target Bioclass
Enzyme
Family
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Function May play a role in signal transduction cascades in terminally differentiated cells.
TTD ID
T27577
Uniprot ID
Q07002
DrugMap ID
TTUMFAR
Ensemble ID
ENST00000360066.6
HGNC ID
HGNC:8751
ChEMBL ID
CHEMBL5316

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 18 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K173(10.00)  LDD0277  [1]
DBIA
 Probe Info  		C411(1.69)  LDD3344  [2]
BTD
 Probe Info  		C185(0.94)  LDD2090  [3]
Johansson_61
 Probe Info  		_(20.00)  LDD1485  [4]
AHL-Pu-1
 Probe Info  		C183(3.04)  LDD0169  [5]
4-Iodoacetamidophenylacetylene
 Probe Info  		C185(0.00); C381(0.00)  LDD0038  [6]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [7]
Lodoacetamide azide
 Probe Info  		C185(0.00); C381(0.00)  LDD0037  [6]
NAIA_5
 Probe Info  		C185(0.00); C206(0.00); C233(0.00)  LDD2224  [8]
WYneN
 Probe Info  		N.A.  LDD0021  [9]
WYneO
 Probe Info  		N.A.  LDD0022  [9]
ENE
 Probe Info  		N.A.  LDD0006  [9]
IPM
 Probe Info  		N.A.  LDD0005  [9]
TFBX
 Probe Info  		N.A.  LDD0148  [10]
VSF
 Probe Info  		N.A.  LDD0007  [9]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [11]
Acrolein
 Probe Info  		N.A.  LDD0217  [12]
HHS-465
 Probe Info  		Y155(0.00); K160(0.00)  LDD2240  [13]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DA-2
 Probe Info  		N.A.  LDD0070  [14]
STS-1
 Probe Info  		N.A.  LDD0068  [15]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0510  3-(4-(Hydroxydiphenylmethyl)piperidin-1-yl)-3-oxopropanenitrile MDA-MB-231 C185(1.30)  LDD2103  [3]
 LDCM0026  4SU-RNA+native RNA HEK-293T C183(3.04)  LDD0169  [5]
 LDCM0498  BS-3668 MDA-MB-231 C185(0.57)  LDD2091  [3]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [12]
 LDCM0632  CL-Sc Hep-G2 C185(1.80); C381(1.75)  LDD2227  [8]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C185(6.51)  LDD1702  [3]
 LDCM0569  Fragment7 Jurkat _(20.00)  LDD1485  [4]
 LDCM0107  IAA HeLa N.A.  LDD0221  [12]
 LDCM0022  KB02 769-P C411(1.37)  LDD2246  [2]
 LDCM0023  KB03 769-P C411(2.01)  LDD2663  [2]
 LDCM0024  KB05 NCI-H146 C411(1.69)  LDD3344  [2]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C185(0.89)  LDD2121  [3]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C185(0.94)  LDD2090  [3]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C185(0.86)  LDD2092  [3]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C185(0.89)  LDD2111  [3]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C185(0.87)  LDD2140  [3]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C185(0.49)  LDD2150  [3]
 LDCM0627  NUDT7-COV-1 HEK-293T C185(0.07)  LDD2206  [16]
 LDCM0628  OTUB2-COV-1 HEK-293T C185(0.70)  LDD2207  [16]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adenylate kinase 8 (AK8) Adenylate kinase family Q96MA6
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
E3 ubiquitin-protein ligase TRIM50 (TRIM50) TRIM/RBCC family Q86XT4
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein zeta/delta (YWHAZ) 14-3-3 family P63104
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Golgin-45 (BLZF1) . Q9H2G9
Homeobox-containing protein 1 (HMBOX1) . Q6NT76
Zinc finger protein 426 (ZNF426) . Q9BUY5
Other
Click To Hide/Show 31 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Coiled-coil domain-containing protein 88B (CCDC88B) CCDC88 family A6NC98
Cyclin-D1-binding protein 1 (CCNDBP1) CCNDBP1 family O95273
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Centrosomal protein of 76 kDa (CEP76) CEP76 family Q8TAP6
G1/S-specific cyclin-D3 (CCND3) Cyclin family P30281
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Golgi reassembly-stacking protein 2 (GORASP2) GORASP family Q9H8Y8
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Liprin-alpha-1 (PPFIA1) Liprin family Q13136
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Mitotic spindle assembly checkpoint protein MAD1 (MAD1L1) MAD1 family Q9Y6D9
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Rab GTPase-binding effector protein 1 (RABEP1) Rabaptin family Q15276
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
Huntingtin-associated protein 1 (HAP1) . P54257
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
TNF receptor-associated factor 1 (TRAF1) . Q13077

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pmid24793884c77 Small molecular drug D0N3LC

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
5 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
6 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
9 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
10 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
11 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
12 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
13 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
14 Cell-based proteome profiling of potential dasatinib targets by use of affinity-based probes. J Am Chem Soc. 2012 Feb 15;134(6):3001-14. doi: 10.1021/ja208518u. Epub 2012 Feb 1.
15 Proteome profiling reveals potential cellular targets of staurosporine using a clickable cell-permeable probe. Chem Commun (Camb). 2011 Oct 28;47(40):11306-8. doi: 10.1039/c1cc14824a. Epub 2011 Sep 16.
16 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.