Details of the Target
General Information of Target
| Target ID | LDTP04988 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thioredoxin reductase-like selenoprotein T (SELENOT) | |||||
| Gene Name | SELENOT | |||||
| Gene ID | 51714 | |||||
| Synonyms |
SELT; Thioredoxin reductase-like selenoprotein T; SelT; EC 1.8.1.9 |
|||||
| 3D Structure | ||||||
| Sequence |
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMR
VISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQW GQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNE MKLNVHMDSIPHHRS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
SelWTH family, Selenoprotein T subfamily
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Selenoprotein with thioredoxin reductase-like oxidoreductase activity. Protects dopaminergic neurons against oxidative stress and cell death. Involved in ADCYAP1/PACAP-induced calcium mobilization and neuroendocrine secretion. Plays a role in fibroblast anchorage and redox regulation. In gastric smooth muscle, modulates the contraction processes through the regulation of calcium release and MYLK activation. In pancreatic islets, involved in the control of glucose homeostasis, contributes to prolonged ADCYAP1/PACAP-induced insulin secretion.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Johansson_61 Probe Info |
![]() |
_(20.00) | LDD1485 | [1] | |
|
YY4-yne Probe Info |
![]() |
8.08 | LDD0400 | [2] | |
Competitor(s) Related to This Target
References


