Details of the Target

General Information of Target

Target ID LDTP02974
Target Name Keratin, type I cytoskeletal 15 (KRT15)
Gene Name KRT15
Gene ID 3866
Synonyms
KRTB; Keratin, type I cytoskeletal 15; Cytokeratin-15; CK-15; Keratin-15; K15
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Target Bioclass
Other
Family
Intermediate filament family
Uniprot ID
P19012
Ensemble ID
ENST00000254043.8
HGNC ID
HGNC:6421

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA Deletion: p.S34VfsTer31 DBIA    Probe Info 
DU145 SNV: p.C380Y .
G415 SNV: p.G99V DBIA    Probe Info 
HKGZCC SNV: p.R379Q DBIA    Probe Info 
KU1919 Deletion: .
Insertion: p.L193_K194dup		 DBIA    Probe Info 
LOXIMVI SNV: p.I137V .
MCC13 Deletion: p.G431_I438del .
SKOV3 SNV: p.G37R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P2
 Probe Info  		3.02  LDD0449  [1]
P3
 Probe Info  		10.00  LDD0450  [1]
P8
 Probe Info  		10.00  LDD0451  [1]
DBIA
 Probe Info  		C355(1.40); C380(1.34)  LDD3314  [2]
Jackson_14
 Probe Info  		5.88  LDD0123  [3]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info  		N.A.  LDD0136  [4]
STS-2
 Probe Info  		1.00  LDD0139  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A431 C355(3.37); C380(2.24)  LDD2258  [2]
 LDCM0023  KB03 A431 C355(2.62); C380(1.73)  LDD2675  [2]
 LDCM0024  KB05 IGR37 C355(1.40); C380(1.34)  LDD3314  [2]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 5.88  LDD0123  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Ribonuclease P protein subunit p25 (RPP25) Histone-like Alba family Q9BUL9
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1) . Q9NPC3
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit O, mitochondrial (ATP5PO) ATPase delta chain family P48047
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 576 (ZNF576) Krueppel C2H2-type zinc-finger protein family Q9H609
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related (HMG20B) . Q9P0W2
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Other
Click To Hide/Show 71 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Abl interactor 2 (ABI2) ABI family Q9NYB9
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Protein BEX2 (BEX2) BEX family Q9BXY8
Nucleolar complex protein 4 homolog (NOC4L) CBF/MAK21 family Q9BVI4
Coiled-coil domain-containing protein 87 (CCDC87) CCDC87 family Q9NVE4
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
Cyclin-C (CCNC) Cyclin family P24863
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Enhancer of polycomb homolog 1 (EPC1) Enhancer of polycomb family Q9H2F5
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Radial spoke head 14 homolog (RSPH14) Flagellar radial spoke RSP14 family Q9UHP6
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Desmin (DES) Intermediate filament family P17661
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb2 (KRT82) Intermediate filament family Q9NSB4
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 1b (KRT77) Intermediate filament family Q7Z794
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 5 (KRT5) Intermediate filament family P13647
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6B (KRT6B) Intermediate filament family P04259
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 73 (KRT73) Intermediate filament family Q86Y46
Keratin, type II cytoskeletal 74 (KRT74) Intermediate filament family Q7RTS7
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Keratin, type II cytoskeletal 80 (KRT80) Intermediate filament family Q6KB66
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Kinesin light chain 4 (KLC4) Kinesin light chain family Q9NSK0
Protein Mis18-beta (OIP5) Mis18 family O43482
Phosphatidylinositol 3-kinase regulatory subunit beta (PIK3R2) PI3K p85 subunit family O00459
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
RIB43A-like with coiled-coils protein 1 (RIBC1) RIB43A family Q8N443
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
Mitochondrial import inner membrane translocase subunit Tim8 A (TIMM8A) Small Tim family O60220
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
Centrosomal protein of 57 kDa (CEP57) Translokin family Q86XR8
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
Arfaptin-2 (ARFIP2) . P53365
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Inhibitor of nuclear factor kappa-B kinase-interacting protein (IKBIP) . Q70UQ0
KAT8 regulatory NSL complex subunit 1 (KANSL1) . Q7Z3B3
LIM domain transcription factor LMO4 (LMO4) . P61968
Methyl-CpG-binding domain protein 3 (MBD3) . O95983
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Phostensin (PPP1R18) . Q6NYC8
Putative ankyrin repeat domain-containing protein 26-like 1 (ANKRD36BP1) . Q96IX9
Rhombotin-2 (LMO2) . P25791
TBC1 domain family member 21 (TBC1D21) . Q8IYX1
WW domain-containing adapter protein with coiled-coil (WAC) . Q9BTA9

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
4 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.