General Information of Target

Target ID LDTP02106
Target Name Intercellular adhesion molecule 1 (ICAM1)
Gene Name ICAM1
Gene ID 3383
Synonyms
Intercellular adhesion molecule 1; ICAM-1; Major group rhinovirus receptor; CD antigen CD54
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Target Type
Successful
Target Bioclass
Immunoglobulin
Family
Immunoglobulin superfamily, ICAM family
Subcellular location
Membrane
Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins.; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins.; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
TTD ID
T57011
Uniprot ID
P05362
DrugMap ID
TTCT6F7
Ensemble ID
ENST00000264832.8
HGNC ID
HGNC:5344
ChEMBL ID
CHEMBL3070

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
YN-1
 Probe Info 
100.00  LDD0444  [1]
OPA-S-S-alkyne
 Probe Info 
K67(1.69); K359(3.71); K469(4.19)  LDD3494  [2]
BTD
 Probe Info 
C332(1.28)  LDD2090  [3]
DBIA
 Probe Info 
C457(1.05); C92(0.95); C96(0.95); C48(0.87)  LDD0078  [4]
IA-alkyne
 Probe Info 
N.A.  LDD0166  [5]
TFBX
 Probe Info 
C332(0.00); C135(0.00)  LDD0148  [6]
Crotonaldehyde
 Probe Info 
N.A.  LDD0219  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0502  1-(Cyanoacetyl)piperidine MDA-MB-231 C332(0.95)  LDD2095  [3]
 LDCM0537  2-Cyano-N,N-dimethylacetamide MDA-MB-231 C332(1.22)  LDD2130  [3]
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C332(1.00)  LDD2152  [3]
 LDCM0539  3-(4-Isopropylpiperazin-1-yl)-3-oxopropanenitrile MDA-MB-231 C332(0.70)  LDD2132  [3]
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C332(0.79)  LDD2131  [3]
 LDCM0545  Acetamide MDA-MB-231 C332(0.86)  LDD2138  [3]
 LDCM0020  ARS-1620 HCC44 C457(1.05); C92(0.95); C96(0.95); C48(0.87)  LDD0078  [4]
 LDCM0498  BS-3668 MDA-MB-231 C332(1.05)  LDD2091  [3]
 LDCM0022  KB02 42-MG-BA C135(1.99)  LDD2244  [8]
 LDCM0023  KB03 769-P C332(3.07); C135(4.65)  LDD2663  [8]
 LDCM0024  KB05 G361 C332(2.33); C135(3.48); C371(2.68)  LDD3311  [8]
 LDCM0528  N-(4-bromophenyl)-2-cyano-N-phenylacetamide MDA-MB-231 C332(1.43)  LDD2121  [3]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C332(1.28)  LDD2090  [3]
 LDCM0504  Nucleophilic fragment 15a MDA-MB-231 C332(0.47)  LDD2097  [3]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C332(1.10)  LDD2099  [3]
 LDCM0507  Nucleophilic fragment 16b MDA-MB-231 C332(1.05)  LDD2100  [3]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C332(0.87)  LDD2104  [3]
 LDCM0513  Nucleophilic fragment 19b MDA-MB-231 C332(0.87)  LDD2106  [3]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C332(1.01)  LDD2107  [3]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C332(1.18)  LDD2108  [3]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C332(1.11)  LDD2109  [3]
 LDCM0517  Nucleophilic fragment 21b MDA-MB-231 C332(0.53)  LDD2110  [3]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C332(0.91)  LDD2111  [3]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C332(0.90)  LDD2114  [3]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C332(1.51)  LDD2116  [3]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C332(2.42)  LDD2118  [3]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C332(0.52)  LDD2120  [3]
 LDCM0530  Nucleophilic fragment 28a MDA-MB-231 C332(0.98)  LDD2123  [3]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C332(1.66)  LDD2124  [3]
 LDCM0534  Nucleophilic fragment 30a MDA-MB-231 C332(0.91)  LDD2127  [3]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C332(0.55)  LDD2128  [3]
 LDCM0540  Nucleophilic fragment 35 MDA-MB-231 C332(0.69)  LDD2133  [3]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C332(0.56)  LDD2135  [3]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C332(1.12); C457(0.79)  LDD2136  [3]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C332(1.10)  LDD2137  [3]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C332(1.09)  LDD2140  [3]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C332(0.57)  LDD2141  [3]
 LDCM0549  Nucleophilic fragment 43 MDA-MB-231 C332(0.39)  LDD2143  [3]
 LDCM0550  Nucleophilic fragment 5a MDA-MB-231 C332(0.76)  LDD2144  [3]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C457(0.88)  LDD2146  [3]
 LDCM0553  Nucleophilic fragment 6b MDA-MB-231 C332(0.58)  LDD2147  [3]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C332(1.25)  LDD2150  [3]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C332(1.00)  LDD2151  [3]
 LDCM0559  Nucleophilic fragment 9b MDA-MB-231 C332(1.94)  LDD2153  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Integrin alpha-L (ITGAL) Integrin alpha chain family P20701
Calcium and integrin-binding protein 1 (CIB1) . Q99828
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Protein pelota homolog (PELO) Eukaryotic release factor 1 family Q9BRX2
Kelch-like ECH-associated protein 1 (KEAP1) KEAP1 family Q14145
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Ubiquilin-2 (UBQLN2) . Q9UHD9

The Drug(s) Related To This Target

Approved
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Isis 1570 Antisense drug D00OTT
Natalizumab BiotechDrug DB00108
Hyaluronic Acid Small molecular drug DB08818
Phase 3
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Alicaforsen Antisense drug D0P9BT
Investigative
Click To Hide/Show 13 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Isis 11158 Antisense drug D0V8KH
Isis 11159 Antisense drug D00FAL
Isis 11665 Antisense drug D0K7HI
Isis 1931 Antisense drug D02ZMH
Isis 2974 Antisense drug D06SDT
Isis 3067 Antisense drug D0J1FW
Isis 3224 Antisense drug D02TKV
A-286982 Small molecular drug D07XCA
Dehydropipernonaline Small molecular drug D0H0FG
Nafamostat Small molecular drug DB12598
Pellitorin Small molecular drug D0ZH9W
Pipernonaline Small molecular drug D0S2UZ
Piperrolein B Small molecular drug D03YAG
Discontinued
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Inxc-icam1 Antisense drug D0M0UV

References

1 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
5 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
6 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
7 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
8 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840