General Information of Target

Target ID LDTP02086
Target Name Protein kinase C gamma type (PRKCG)
Gene Name PRKCG
Gene ID 5582
Synonyms
PKCG; Protein kinase C gamma type; PKC-gamma; EC 2.7.11.13
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Target Type
Successful
Target Bioclass
Enzyme
Family
Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily
Subcellular location
Cytoplasm
Function
Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays diverse roles in neuronal cells and eye tissues, such as regulation of the neuronal receptors GRIA4/GLUR4 and GRIN1/NMDAR1, modulation of receptors and neuronal functions related to sensitivity to opiates, pain and alcohol, mediation of synaptic function and cell survival after ischemia, and inhibition of gap junction activity after oxidative stress. Binds and phosphorylates GRIA4/GLUR4 glutamate receptor and regulates its function by increasing plasma membrane-associated GRIA4 expression. In primary cerebellar neurons treated with the agonist 3,5-dihyidroxyphenylglycine, functions downstream of the metabotropic glutamate receptor GRM5/MGLUR5 and phosphorylates GRIN1/NMDAR1 receptor which plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. May be involved in the regulation of hippocampal long-term potentiation (LTP), but may be not necessary for the process of synaptic plasticity. May be involved in desensitization of mu-type opioid receptor-mediated G-protein activation in the spinal cord, and may be critical for the development and/or maintenance of morphine-induced reinforcing effects in the limbic forebrain. May modulate the functionality of mu-type-opioid receptors by participating in a signaling pathway which leads to the phosphorylation and degradation of opioid receptors. May also contributes to chronic morphine-induced changes in nociceptive processing. Plays a role in neuropathic pain mechanisms and contributes to the maintenance of the allodynia pain produced by peripheral inflammation. Plays an important role in initial sensitivity and tolerance to ethanol, by mediating the behavioral effects of ethanol as well as the effects of this drug on the GABA(A) receptors. During and after cerebral ischemia modulate neurotransmission and cell survival in synaptic membranes, and is involved in insulin-induced inhibition of necrosis, an important mechanism for minimizing ischemic injury. Required for the elimination of multiple climbing fibers during innervation of Purkinje cells in developing cerebellum. Is activated in lens epithelial cells upon hydrogen peroxide treatment, and phosphorylates connexin-43 (GJA1/CX43), resulting in disassembly of GJA1 gap junction plaques and inhibition of gap junction activity which could provide a protective effect against oxidative stress. Phosphorylates p53/TP53 and promotes p53/TP53-dependent apoptosis in response to DNA damage. Involved in the phase resetting of the cerebral cortex circadian clock during temporally restricted feeding. Stabilizes the core clock component BMAL1 by interfering with its ubiquitination, thus suppressing its degradation, resulting in phase resetting of the cerebral cortex clock.
TTD ID
T47107
Uniprot ID
P05129
DrugMap ID
TTRFOXJ
Ensemble ID
ENST00000263431.4
HGNC ID
HGNC:9402
ChEMBL ID
CHEMBL2938

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT116 SNV: p.A378V; p.H456R .
HEC1 SNV: p.N485I .
HEC1B SNV: p.N485I .
HELA SNV: p.E623G .
IGR1 SNV: p.E623G .
IGROV1 SNV: p.P334H .
KPL1 SNV: p.Q425Ter .
MFE319 Deletion: p.T510RfsTer13
SNV: p.R104H
.
NCIH358 SNV: p.R314L .
NCIH446 SNV: p.S251A .
OSRC2 SNV: p.H445R .
REH SNV: p.D679N DBIA    Probe Info 
RL952 SNV: p.A378T .
SUPT1 SNV: p.L207P .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C586(0.79)  LDD3334  [1]
ATP probe
 Probe Info 
K197(0.00); K199(0.00)  LDD0199  [2]
NAIA_4
 Probe Info 
N.A.  LDD2226  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C516(1.13)  LDD1510  [4]
 LDCM0259  AC14 HEK-293T C516(0.95)  LDD1512  [4]
 LDCM0270  AC15 HEK-293T C516(0.94)  LDD1513  [4]
 LDCM0280  AC20 HEK-293T C516(1.04)  LDD1519  [4]
 LDCM0281  AC21 HEK-293T C516(0.93)  LDD1520  [4]
 LDCM0282  AC22 HEK-293T C516(1.06)  LDD1521  [4]
 LDCM0283  AC23 HEK-293T C516(0.99)  LDD1522  [4]
 LDCM0284  AC24 HEK-293T C516(1.00)  LDD1523  [4]
 LDCM0288  AC28 HEK-293T C516(1.12)  LDD1527  [4]
 LDCM0289  AC29 HEK-293T C516(0.92)  LDD1528  [4]
 LDCM0291  AC30 HEK-293T C516(0.97)  LDD1530  [4]
 LDCM0292  AC31 HEK-293T C516(1.05)  LDD1531  [4]
 LDCM0293  AC32 HEK-293T C516(1.00)  LDD1532  [4]
 LDCM0297  AC36 HEK-293T C516(1.16)  LDD1536  [4]
 LDCM0298  AC37 HEK-293T C516(0.95)  LDD1537  [4]
 LDCM0299  AC38 HEK-293T C516(1.02)  LDD1538  [4]
 LDCM0300  AC39 HEK-293T C516(0.98)  LDD1539  [4]
 LDCM0301  AC4 HEK-293T C516(1.22)  LDD1540  [4]
 LDCM0302  AC40 HEK-293T C516(0.99)  LDD1541  [4]
 LDCM0306  AC44 HEK-293T C516(1.19)  LDD1545  [4]
 LDCM0307  AC45 HEK-293T C516(0.91)  LDD1546  [4]
 LDCM0308  AC46 HEK-293T C516(1.10)  LDD1547  [4]
 LDCM0309  AC47 HEK-293T C516(0.97)  LDD1548  [4]
 LDCM0310  AC48 HEK-293T C516(1.11)  LDD1549  [4]
 LDCM0312  AC5 HEK-293T C516(0.93)  LDD1551  [4]
 LDCM0315  AC52 HEK-293T C516(1.19)  LDD1554  [4]
 LDCM0316  AC53 HEK-293T C516(1.00)  LDD1555  [4]
 LDCM0317  AC54 HEK-293T C516(1.10)  LDD1556  [4]
 LDCM0318  AC55 HEK-293T C516(1.03)  LDD1557  [4]
 LDCM0319  AC56 HEK-293T C516(0.98)  LDD1558  [4]
 LDCM0323  AC6 HEK-293T C516(1.07)  LDD1562  [4]
 LDCM0324  AC60 HEK-293T C516(1.07)  LDD1563  [4]
 LDCM0325  AC61 HEK-293T C516(0.98)  LDD1564  [4]
 LDCM0326  AC62 HEK-293T C516(1.09)  LDD1565  [4]
 LDCM0327  AC63 HEK-293T C516(0.98)  LDD1566  [4]
 LDCM0328  AC64 HEK-293T C516(1.01)  LDD1567  [4]
 LDCM0334  AC7 HEK-293T C516(1.11)  LDD1568  [4]
 LDCM0345  AC8 HEK-293T C516(1.08)  LDD1569  [4]
 LDCM0248  AKOS034007472 HEK-293T C516(0.95)  LDD1511  [4]
 LDCM0275  AKOS034007705 HEK-293T C516(1.00)  LDD1514  [4]
 LDCM0368  CL10 HEK-293T C516(1.20)  LDD1572  [4]
 LDCM0369  CL100 HEK-293T C516(0.91)  LDD1573  [4]
 LDCM0372  CL103 HEK-293T C516(1.07)  LDD1576  [4]
 LDCM0373  CL104 HEK-293T C516(1.00)  LDD1577  [4]
 LDCM0376  CL107 HEK-293T C516(0.95)  LDD1580  [4]
 LDCM0377  CL108 HEK-293T C516(0.97)  LDD1581  [4]
 LDCM0379  CL11 HEK-293T C516(1.39)  LDD1583  [4]
 LDCM0381  CL111 HEK-293T C516(0.93)  LDD1585  [4]
 LDCM0382  CL112 HEK-293T C516(0.98)  LDD1586  [4]
 LDCM0385  CL115 HEK-293T C516(0.97)  LDD1589  [4]
 LDCM0386  CL116 HEK-293T C516(0.93)  LDD1590  [4]
 LDCM0389  CL119 HEK-293T C516(1.09)  LDD1593  [4]
 LDCM0390  CL12 HEK-293T C516(1.18)  LDD1594  [4]
 LDCM0391  CL120 HEK-293T C516(1.00)  LDD1595  [4]
 LDCM0394  CL123 HEK-293T C516(1.01)  LDD1598  [4]
 LDCM0395  CL124 HEK-293T C516(0.97)  LDD1599  [4]
 LDCM0398  CL127 HEK-293T C516(0.95)  LDD1602  [4]
 LDCM0399  CL128 HEK-293T C516(0.96)  LDD1603  [4]
 LDCM0402  CL15 HEK-293T C516(0.94)  LDD1606  [4]
 LDCM0403  CL16 HEK-293T C516(0.99)  LDD1607  [4]
 LDCM0408  CL20 HEK-293T C516(1.02)  LDD1612  [4]
 LDCM0409  CL21 HEK-293T C516(1.09)  LDD1613  [4]
 LDCM0410  CL22 HEK-293T C516(1.21)  LDD1614  [4]
 LDCM0411  CL23 HEK-293T C516(1.27)  LDD1615  [4]
 LDCM0412  CL24 HEK-293T C516(1.21)  LDD1616  [4]
 LDCM0415  CL27 HEK-293T C516(0.93)  LDD1619  [4]
 LDCM0416  CL28 HEK-293T C516(0.94)  LDD1620  [4]
 LDCM0418  CL3 HEK-293T C516(0.96)  LDD1622  [4]
 LDCM0421  CL32 HEK-293T C516(1.02)  LDD1625  [4]
 LDCM0422  CL33 HEK-293T C516(1.12)  LDD1626  [4]
 LDCM0423  CL34 HEK-293T C516(1.25)  LDD1627  [4]
 LDCM0424  CL35 HEK-293T C516(1.06)  LDD1628  [4]
 LDCM0425  CL36 HEK-293T C516(1.22)  LDD1629  [4]
 LDCM0428  CL39 HEK-293T C516(0.99)  LDD1632  [4]
 LDCM0429  CL4 HEK-293T C516(1.21)  LDD1633  [4]
 LDCM0430  CL40 HEK-293T C516(0.95)  LDD1634  [4]
 LDCM0434  CL44 HEK-293T C516(1.05)  LDD1638  [4]
 LDCM0435  CL45 HEK-293T C516(1.03)  LDD1639  [4]
 LDCM0436  CL46 HEK-293T C516(1.11)  LDD1640  [4]
 LDCM0437  CL47 HEK-293T C516(1.21)  LDD1641  [4]
 LDCM0438  CL48 HEK-293T C516(1.21)  LDD1642  [4]
 LDCM0443  CL52 HEK-293T C516(1.05)  LDD1646  [4]
 LDCM0447  CL56 HEK-293T C516(0.99)  LDD1650  [4]
 LDCM0448  CL57 HEK-293T C516(0.94)  LDD1651  [4]
 LDCM0449  CL58 HEK-293T C516(1.16)  LDD1652  [4]
 LDCM0450  CL59 HEK-293T C516(1.23)  LDD1653  [4]
 LDCM0452  CL60 HEK-293T C516(1.11)  LDD1655  [4]
 LDCM0455  CL63 HEK-293T C516(1.04)  LDD1658  [4]
 LDCM0456  CL64 HEK-293T C516(0.97)  LDD1659  [4]
 LDCM0460  CL68 HEK-293T C516(1.10)  LDD1663  [4]
 LDCM0461  CL69 HEK-293T C516(0.93)  LDD1664  [4]
 LDCM0463  CL70 HEK-293T C516(1.22)  LDD1666  [4]
 LDCM0464  CL71 HEK-293T C516(1.28)  LDD1667  [4]
 LDCM0465  CL72 HEK-293T C516(1.18)  LDD1668  [4]
 LDCM0469  CL76 HEK-293T C516(1.03)  LDD1672  [4]
 LDCM0473  CL8 HEK-293T C516(0.96)  LDD1676  [4]
 LDCM0474  CL80 HEK-293T C516(1.07)  LDD1677  [4]
 LDCM0475  CL81 HEK-293T C516(1.06)  LDD1678  [4]
 LDCM0476  CL82 HEK-293T C516(1.13)  LDD1679  [4]
 LDCM0477  CL83 HEK-293T C516(1.05)  LDD1680  [4]
 LDCM0478  CL84 HEK-293T C516(1.13)  LDD1681  [4]
 LDCM0481  CL87 HEK-293T C516(0.92)  LDD1684  [4]
 LDCM0482  CL88 HEK-293T C516(1.00)  LDD1685  [4]
 LDCM0484  CL9 HEK-293T C516(1.09)  LDD1687  [4]
 LDCM0487  CL92 HEK-293T C516(1.01)  LDD1690  [4]
 LDCM0488  CL93 HEK-293T C516(1.02)  LDD1691  [4]
 LDCM0489  CL94 HEK-293T C516(1.10)  LDD1692  [4]
 LDCM0490  CL95 HEK-293T C516(1.10)  LDD1693  [4]
 LDCM0491  CL96 HEK-293T C516(1.16)  LDD1694  [4]
 LDCM0494  CL99 HEK-293T C516(1.02)  LDD1697  [4]
 LDCM0495  E2913 HEK-293T C516(1.02)  LDD1698  [4]
 LDCM0468  Fragment33 HEK-293T C516(1.00)  LDD1671  [4]
 LDCM0022  KB02 697 C502(1.29)  LDD2245  [1]
 LDCM0023  KB03 697 C502(1.56)  LDD2662  [1]
 LDCM0024  KB05 MOLM-16 C586(0.79)  LDD3334  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
E3 SUMO-protein ligase PIAS1 (PIAS1) PIAS family O75925
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM167A (FAM167A) FAM167 (SEC) family Q96KS9
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
T-complex protein 10A homolog 1 (TCP10L) TCP10 family Q8TDR4

The Drug(s) Related To This Target

Approved
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dequalinium Small molecular drug DB04209
Fostamatinib Small molecular drug DB12010
Midostaurin Small molecular drug D07NVU
Tamoxifen Small molecular drug DB00675
Benzoyl Peroxide . DB09096
Investigative
Click To Hide/Show 26 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(-)-cercosporamide Small molecular drug D0L1YA
2,3,3-triphenyl-acrylonitrile Small molecular drug D0S9UK
2-(4-hydroxy-phenyl)-3,3-diphenyl-acrylonitrile Small molecular drug D02QME
3,3-bis-(4-hydroxy-phenyl)-2-phenyl-acrylonitrile Small molecular drug D0T0UH
3,3-bis-(4-methoxy-phenyl)-2-phenyl-acrylonitrile Small molecular drug D0A8MN
3,4-di-(4-methoxyphenyl)-1h-pyrrole-2,5-dione Small molecular drug D00NYT
3,4-diphenyl-1h-pyrrole-2,5-dione Small molecular drug D0C3WY
3-(4-hydroxy-phenyl)-2,3-diphenyl-acrylonitrile Small molecular drug D09XIE
3-(4-methoxyphenyl)-4-phenyl-1h-pyrrole-2,5-dione Small molecular drug D0EK0G
3-(Indole-3-yl)-4-phenyl-1h-pyrrole-2,5-dione Small molecular drug D06AOY
4-cycloheptyliden(4-hydroxyphenyl)Methylphenol Small molecular drug D0Q3GQ
4-cyclohexyliden(4-hydroxyphenyl)Methylphenol Small molecular drug D0V9SW
4-cyclopentyliden(4-hydroxyphenyl)Methylphenol Small molecular drug D04OHM
4-[1-(4-hydroxyphenyl)-3-methyl-1-butenyl]Phenol Small molecular drug D02PUV
8-octyl-benzolactam-v9 Small molecular drug D04AXH
Bisindolylmaleimide-i Small molecular drug D0TO6S
Go 6983 Small molecular drug D06TLL
Ly-326449 Small molecular drug D06ZCX
Monoctanoin Component C Small molecular drug D08GFG
Prostratin Small molecular drug D04JNZ
Ro-316233 Small molecular drug D0L8HO
Ro-32-0557 Small molecular drug D09TSC
Staurosporine Small molecular drug DB02010
[2,2':5',2'terthiophen-4-yl-methanol Small molecular drug D00TWA
[2,2':5',2'terthiophene-4,5''-dicarbaldehyde Small molecular drug D05LRV
[2,2':5',2'terthiophene-4-carbaldehyde Small molecular drug D0D3MR
Discontinued
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Balanol Small molecular drug D0R2TM
Ly-317644 Small molecular drug D0X0HN
Ro-320432 Small molecular drug D0R5ZR

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402