Details of the Target

General Information of Target

Target ID LDTP01970
Target Name Serotransferrin (TF)
Gene Name TF
Gene ID 7018
Synonyms
Serotransferrin; Transferrin; Beta-1 metal-binding globulin; Siderophilin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC
ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP
VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN
IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF
RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL
HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
Target Type
Clinical trial
Target Bioclass
Other
Family
Transferrin family
Subcellular location
Secreted
Function
Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.; (Microbial infection) Serves as an iron source for Neisseria species, which capture the protein and extract its iron for their own use.; (Microbial infection) Serves as an iron source for parasite T.brucei (strain 427), which capture TF via its own transferrin receptor ESAG6:ESAG7 and extract its iron for its own use.
TTD ID
T02617
Uniprot ID
P02787
DrugMap ID
TTV5YEH
Ensemble ID
ENST00000402696.9
HGNC ID
HGNC:11740
ChEMBL ID
CHEMBL4865

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
W1
 Probe Info  		75.43  LDD0235  [1]
YN-1
 Probe Info  		100.00  LDD0444  [2]
YN-4
 Probe Info  		100.00  LDD0445  [2]
IPM
 Probe Info  		C469(0.00); C350(0.00); C656(0.00); C503(0.00)  LDD0241  [1]
OPA-S-S-alkyne
 Probe Info  		K467(0.07); K135(1.26); K134(2.36)  LDD3494  [3]
DBIA
 Probe Info  		C469(1.01)  LDD3314  [4]
BTD
 Probe Info  		C469(1.29)  LDD2101  [5]
YY4-yne
 Probe Info  		3.57  LDD0400  [6]
Acrolein
 Probe Info  		N.A.  LDD0222  [7]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [8]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [8]
ATP probe
 Probe Info  		N.A.  LDD0035  [9]
NAIA_5
 Probe Info  		N.A.  LDD2223  [10]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Alk-rapa
 Probe Info  		2.67  LDD0213  [11]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C137(0.85)  LDD1508  [12]
 LDCM0277  AC18 HEK-293T C137(0.89)  LDD1516  [12]
 LDCM0279  AC2 HEK-293T C137(1.02)  LDD1518  [12]
 LDCM0286  AC26 HEK-293T C137(0.83)  LDD1525  [12]
 LDCM0295  AC34 HEK-293T C137(1.46)  LDD1534  [12]
 LDCM0304  AC42 HEK-293T C137(1.16)  LDD1543  [12]
 LDCM0313  AC50 HEK-293T C137(0.86)  LDD1552  [12]
 LDCM0321  AC58 HEK-293T C137(1.00)  LDD1560  [12]
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [7]
 LDCM0367  CL1 HEK-293T C137(0.85)  LDD1571  [12]
 LDCM0370  CL101 HEK-293T C137(0.95)  LDD1574  [12]
 LDCM0374  CL105 HEK-293T C137(1.03)  LDD1578  [12]
 LDCM0378  CL109 HEK-293T C137(1.02)  LDD1582  [12]
 LDCM0383  CL113 HEK-293T C137(1.09)  LDD1587  [12]
 LDCM0387  CL117 HEK-293T C137(1.11)  LDD1591  [12]
 LDCM0392  CL121 HEK-293T C137(1.01)  LDD1596  [12]
 LDCM0396  CL125 HEK-293T C137(0.82)  LDD1600  [12]
 LDCM0400  CL13 HEK-293T C137(1.00)  LDD1604  [12]
 LDCM0405  CL18 HEK-293T C137(0.96)  LDD1609  [12]
 LDCM0413  CL25 HEK-293T C137(0.97)  LDD1617  [12]
 LDCM0419  CL30 HEK-293T C137(0.93)  LDD1623  [12]
 LDCM0426  CL37 HEK-293T C137(0.93)  LDD1630  [12]
 LDCM0432  CL42 HEK-293T C137(0.84)  LDD1636  [12]
 LDCM0439  CL49 HEK-293T C137(0.96)  LDD1643  [12]
 LDCM0445  CL54 HEK-293T C137(0.99)  LDD1648  [12]
 LDCM0451  CL6 HEK-293T C137(0.91)  LDD1654  [12]
 LDCM0453  CL61 HEK-293T C137(0.97)  LDD1656  [12]
 LDCM0458  CL66 HEK-293T C137(1.03)  LDD1661  [12]
 LDCM0466  CL73 HEK-293T C137(1.03)  LDD1669  [12]
 LDCM0471  CL78 HEK-293T C137(1.01)  LDD1674  [12]
 LDCM0479  CL85 HEK-293T C137(0.78)  LDD1682  [12]
 LDCM0485  CL90 HEK-293T C137(1.27)  LDD1688  [12]
 LDCM0492  CL97 HEK-293T C137(1.03)  LDD1695  [12]
 LDCM0022  KB02 769-P C469(1.14)  LDD2246  [4]
 LDCM0023  KB03 A101D C596(4.28)  LDD2667  [4]
 LDCM0024  KB05 IGR37 C469(1.01)  LDD3314  [4]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C469(1.29)  LDD2101  [5]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C469(0.96)  LDD2111  [5]
 LDCM0090  Rapamycin JHH-7 2.67  LDD0213  [11]
 LDCM0113  W17 Hep-G2 C469(6.47)  LDD0240  [1]
 LDCM0154  YY4 T cell 3.57  LDD0400  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Claudin-5 (CLDN5) Claudin family O00501
Gap junction beta-1 protein (GJB1) Connexin family P08034
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
Aquaporin-9 (AQP9) MIP/aquaporin (TC 1.A.8) family O43315
Transferrin receptor protein 1 (TFRC) Peptidase M28 family P02786
Sortilin (SORT1) VPS10-related sortilin family Q99523
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paired-like homeodomain transcription factor LEUTX (LEUTX) Paired homeobox family A8MZ59
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
Gastrin (GAST) Gastrin/cholecystokinin family P01350
Golgi membrane protein 1 (GOLM1) GOLM family Q8NBJ4
Regulator of microtubule dynamics protein 3 (RMDN3) RMDN family Q96TC7
Synaptotagmin-2 (SYT2) Synaptotagmin family Q8N9I0
Transmembrane protein 52B (TMEM52B) . Q4KMG9

The Drug(s) Related To This Target

Approved
Click To Hide/Show 27 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Aluminium Small molecular drug DB01370
Cisplatin Small molecular drug DB00515
Gallium Nitrate Small molecular drug DB05260
Iron Small molecular drug DB01592
Iron Dextran Small molecular drug DB00893
Isoflurophate Small molecular drug DB00677
Manganese Small molecular drug DB06757
Aluminium Phosphate . DB14517
Aluminum Acetate . DB14518
Chromic Nitrate . DB14527
Chromium . DB11136
Chromium Gluconate . DB14528
Chromium Nicotinate . DB14529
Chromous Sulfate . DB14530
Copper . DB09130
Ferric Cation . DB13949
Ferrous Ascorbate . DB14490
Ferrous Fumarate . DB14491
Ferrous Gluconate . DB14488
Ferrous Glycine Sulfate . DB14501
Ferrous Succinate . DB14489
Ferrous Sulfate Anhydrous . DB13257
Tetraferric Tricitrate Decahydrate . DB14520
Zinc . DB01593
Zinc Acetate . DB14487
Zinc Chloride . DB14533
Zinc Sulfate Unspecified Form . DB14548
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Calaa-01 . D0A1GR
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ep-2167 . D0QB8Q
Investigative
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Chromic Citrate . DB14526
Dichlorvos . DB11397

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
3 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 A Chemical Proteomic Probe for the Mitochondrial Pyruvate Carrier Complex. Angew Chem Int Ed Engl. 2020 Mar 2;59(10):3896-3899. doi: 10.1002/anie.201914391. Epub 2020 Feb 11.
7 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
9 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
10 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
11 Rapamycin targets STAT3 and impacts c-Myc to suppress tumor growth. Cell Chem Biol. 2022 Mar 17;29(3):373-385.e6. doi: 10.1016/j.chembiol.2021.10.006. Epub 2021 Oct 26.
12 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402