Details of the Target
General Information of Target
| Target ID | LDTP00042 | |||||
|---|---|---|---|---|---|---|
| Target Name | Probable ribonuclease ZC3H12D (ZC3H12D) | |||||
| Gene Name | ZC3H12D | |||||
| Gene ID | 340152 | |||||
| Synonyms |
C6orf95; MCPIP4; TFL; Probable ribonuclease ZC3H12D; EC 3.1.-.-; MCP-induced protein 4; Transformed follicular lymphoma; Zinc finger CCCH domain-containing protein 12D; p34 |
|||||
| 3D Structure | ||||||
| Sequence |
MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVP
RGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP SLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG AGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGP PLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARAR ARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
ZC3H12 family
|
|||||
| Subcellular location |
Cytoplasm; Cytoplasm, P-body
|
|||||
| Function |
May regulate cell growth likely by suppressing RB1 phosphorylation. May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages. Serve as a tumor suppressor in certain leukemia cells. Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C312(1.35) | LDD3325 | [1] | |
|
IA-alkyne Probe Info |
![]() |
12.59 | LDD0431 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C64(1.28); C517(1.18); C177(1.85) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C64(2.30); C517(1.10); C177(0.99) | LDD2189 | [3] |
| LDCM0573 | Fragment11 | Ramos | C64(1.87); C111(6.54) | LDD2190 | [3] |
| LDCM0574 | Fragment12 | Ramos | C64(1.19); C517(0.89); C177(1.16) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C64(0.96); C517(0.50); C177(1.48); C367(0.78) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C64(1.04); C517(1.09); C177(0.62); C367(2.41) | LDD2193 | [3] |
| LDCM0579 | Fragment20 | Ramos | C64(1.68); C177(0.55) | LDD2194 | [3] |
| LDCM0580 | Fragment21 | Ramos | C64(0.97); C517(0.41); C177(2.02); C367(0.90) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C64(0.92); C517(0.51); C177(0.62); C367(0.67) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C64(0.83); C517(0.42); C177(1.08); C367(0.91) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C64(0.81); C517(0.43); C177(1.08); C367(0.79) | LDD2198 | [3] |
| LDCM0587 | Fragment29 | Ramos | C367(1.33) | LDD1476 | [4] |
| LDCM0588 | Fragment30 | Ramos | C64(1.26); C517(0.50); C177(1.07); C367(1.27) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C367(1.88) | LDD1478 | [4] |
| LDCM0590 | Fragment32 | Ramos | C64(1.93); C517(1.00) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C64(1.25); C517(0.65); C177(2.58); C367(1.48) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C64(0.98); C517(0.56); C177(0.81); C367(0.95) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C64(1.39); C517(1.60); C177(1.02); C367(1.04) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C64(1.16); C517(0.70); C177(1.25) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C64(1.30); C517(0.52); C177(1.00) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C64(1.45); C517(1.87); C177(0.97) | LDD2186 | [3] |
| LDCM0571 | Fragment9 | Ramos | C367(5.20) | LDD1464 | [4] |
| LDCM0022 | KB02 | Ramos | 12.59 | LDD0431 | [2] |
| LDCM0023 | KB03 | Ramos | C64(1.07); C517(1.67); C177(0.97); C111(1.56) | LDD2183 | [3] |
| LDCM0024 | KB05 | UACC257 | C312(1.35) | LDD3325 | [1] |
References


