Details of the Target

General Information of Target

Target ID LDTP14192
Target Name MORF4 family-associated protein 1 (MRFAP1)
Gene Name MRFAP1
Gene ID 93621
Synonyms
PAM14; PGR1; MORF4 family-associated protein 1; Protein PGR1; Protein associated with MRG of 14 kDa
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVL
HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
VCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA
RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE
PYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Target Bioclass
Other
Family
MORF4 family-associated protein family
Subcellular location
Nucleus
Uniprot ID
Q9Y605
Ensemble ID
ENST00000320912.8
HGNC ID
HGNC:24549

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		13.63  LDD0403  [1]
DA-P3
 Probe Info  		4.13  LDD0182  [2]
IA-alkyne
 Probe Info  		C97(0.75)  LDD2182  [3]
Acrolein
 Probe Info  		N.A.  LDD0224  [4]
NAIA_5
 Probe Info  		N.A.  LDD2225  [5]
IPM
 Probe Info  		N.A.  LDD0147  [6]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [7]
AOyne
 Probe Info  		13.90  LDD0443  [8]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C052
 Probe Info  		6.23  LDD1750  [9]
C299
 Probe Info  		8.82  LDD1968  [9]
C305
 Probe Info  		9.78  LDD1974  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 13.63  LDD0403  [1]
 LDCM0632  CL-Sc Hep-G2 C97(1.31)  LDD2227  [5]
 LDCM0625  F8 Ramos C97(1.00)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C97(0.12)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C97(20.00)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C97(0.10)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C97(0.13)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C97(0.18)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C97(0.19)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C97(0.17)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C97(0.79)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C97(0.17)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C97(0.84)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C97(0.13)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C97(0.37)  LDD2200  [3]
 LDCM0590  Fragment32 Ramos C97(0.16)  LDD2201  [3]
 LDCM0468  Fragment33 Ramos C97(0.26)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C97(0.84)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C97(0.75)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C97(0.25)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C97(0.36)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C97(0.56)  LDD2186  [3]
 LDCM0571  Fragment9 Ramos C97(0.20)  LDD2188  [3]
 LDCM0022  KB02 Ramos C97(0.75)  LDD2182  [3]
 LDCM0023  KB03 Ramos C97(1.12)  LDD2183  [3]
 LDCM0024  KB05 Ramos C97(1.29)  LDD2185  [3]
 LDCM0030  Luteolin HEK-293T 4.13  LDD0182  [2]
 LDCM0109  NEM HeLa N.A.  LDD0224  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone-lysine N-methyltransferase SUV39H2 (SUV39H2) Histone-lysine methyltransferase family Q9H5I1
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Pterin-4-alpha-carbinolamine dehydratase 2 (PCBD2) Pterin-4-alpha-carbinolamine dehydratase family Q9H0N5
Ribose-phosphate pyrophosphokinase 1 (PRPS1) Ribose-phosphate pyrophosphokinase family P60891
GTPase HRas (HRAS) Ras family P01112
Thioredoxin (TXN) Thioredoxin family P10599
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
Ubiquitin domain-containing protein 1 (UBTD1) . Q9HAC8
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Syntenin-1 (SDCBP) . O00560
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Ataxin-1 (ATXN1) ATXN1 family P54253
Protein BRICK1 (BRK1) BRK1 family Q8WUW1
Caveolae-associated protein 3 (CAVIN3) CAVIN family Q969G5
Protein dpy-30 homolog (DPY30) Dpy-30 family Q9C005
. GOLGA8 family Q08AF8
Ganglioside-induced differentiation-associated protein 1 (GDAP1) GST superfamily Q8TB36
Translation initiation factor IF-3, mitochondrial (MTIF3) IF-3 family Q9H2K0
MORF4 family-associated protein 1-like 1 (MRFAP1L1) MORF4 family-associated protein family Q96HT8
Alpha-2-macroglobulin (A2M) Protease inhibitor I39 (alpha-2-macroglobulin) family P01023
WD40 repeat-containing protein SMU1 (SMU1) WD repeat SMU1 family Q2TAY7
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Doublecortin domain-containing protein 2 (DCDC2) . Q9UHG0
Mortality factor 4-like protein 1 (MORF4L1) . Q9UBU8
Mortality factor 4-like protein 2 (MORF4L2) . Q15014
Proline-rich acidic protein 1 (PRAP1) . Q96NZ9
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Ubiquinol-cytochrome c reductase complex assembly factor 2 (UQCC2) . Q9BRT2
Uncharacterized protein C14orf93 (C14orf93) . Q9H972
Uncharacterized protein C3orf62 (C3orf62) . Q6ZUJ4

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
7 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
8 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
9 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587