Details of the Target
General Information of Target
Target ID | LDTP12951 | |||||
---|---|---|---|---|---|---|
Target Name | Spliceosome-associated protein CWC15 homolog (CWC15) | |||||
Gene Name | CWC15 | |||||
Gene ID | 51503 | |||||
Synonyms |
C11orf5; Spliceosome-associated protein CWC15 homolog |
|||||
3D Structure | ||||||
Sequence |
MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTV
LLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGF HLLCFFMYLYSMILALIND |
|||||
Target Bioclass |
Other
|
|||||
Family |
CWC15 family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Involved in pre-mRNA splicing as component of the spliceosome. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable).
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FBP2 Probe Info |
![]() |
3.18 | LDD0323 | [1] | |
STPyne Probe Info |
![]() |
K91(3.03) | LDD0277 | [2] | |
Probe 1 Probe Info |
![]() |
Y43(13.31) | LDD3495 | [3] | |
NAIA_5 Probe Info |
![]() |
C197(20.00) | LDD2227 | [4] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [5] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [6] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [5] | |
IPM Probe Info |
![]() |
N.A. | LDD0025 | [7] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
1d-yne Probe Info |
![]() |
N.A. | LDD0356 | [8] | |
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [9] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C338 Probe Info |
![]() |
13.93 | LDD2001 | [10] | |
C355 Probe Info |
![]() |
23.75 | LDD2016 | [10] | |
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [11] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References