Details of the Target

General Information of Target

Target ID LDTP11987
Target Name Reticulophagy regulator 1 (RETREG1)
Gene Name RETREG1
Gene ID 54463
Synonyms
FAM134B; JK1; Reticulophagy regulator 1; Reticulophagy receptor 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLD
LFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAIT
TLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQ
AHSALGIPLPRSVAPRQR
Target Bioclass
Transporter and channel
Family
RETREG family
Subcellular location
Endoplasmic reticulum membrane; Golgi apparatus, cis-Golgi network membrane
Function
Endoplasmic reticulum (ER)-anchored autophagy regulator which mediates ER delivery into lysosomes through sequestration into autophagosomes. Promotes membrane remodeling and ER scission via its membrane bending capacity and targets the fragments into autophagosomes via interaction with ATG8 family proteins. Active under basal conditions. Required for collagen quality control in a LIR motif-dependent manner. Required for long-term survival of nociceptive and autonomic ganglion neurons.; (Microbial infection) During SARS-CoV-2 infection, RETREG1-mediated reticulophagy is promoted by SARS-CoV-2 ORF3A protein. This induces endoplasmic reticulum stress and inflammatory responses and facilitates viral infection.
Uniprot ID
Q9H6L5
Ensemble ID
ENST00000306320.10
HGNC ID
HGNC:25964

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A3KAW SNV: p.G431S .
LNCaP clone FGC SNV: p.D162V .
NCIH358 SNV: p.Q191H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TG42
 Probe Info  		5.91  LDD0043  [1]
IPM
 Probe Info  		N.A.  LDD0241  [2]
Johansson_61
 Probe Info  		_(20.00)  LDD1489  [3]
NAIA_5
 Probe Info  		C289(1.01)  LDD2227  [4]
AHL-Pu-1
 Probe Info  		C289(3.80)  LDD0168  [5]
DBIA
 Probe Info  		C235(1.02)  LDD1573  [6]
IA-alkyne
 Probe Info  		N.A.  LDD0166  [7]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [8]
NAIA_4
 Probe Info  		N.A.  LDD2226  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA HEK-293T C289(3.80)  LDD0168  [5]
 LDCM0026  4SU-RNA+native RNA HEK-293T C289(2.22)  LDD0169  [5]
 LDCM0632  CL-Sc Hep-G2 C289(1.01)  LDD2227  [4]
 LDCM0369  CL100 HEK-293T C235(1.02)  LDD1573  [6]
 LDCM0373  CL104 HEK-293T C235(1.03)  LDD1577  [6]
 LDCM0377  CL108 HEK-293T C235(0.95)  LDD1581  [6]
 LDCM0382  CL112 HEK-293T C235(1.01)  LDD1586  [6]
 LDCM0386  CL116 HEK-293T C235(1.25)  LDD1590  [6]
 LDCM0391  CL120 HEK-293T C235(0.99)  LDD1595  [6]
 LDCM0395  CL124 HEK-293T C235(1.02)  LDD1599  [6]
 LDCM0399  CL128 HEK-293T C235(0.99)  LDD1603  [6]
 LDCM0403  CL16 HEK-293T C235(1.12)  LDD1607  [6]
 LDCM0416  CL28 HEK-293T C235(1.01)  LDD1620  [6]
 LDCM0429  CL4 HEK-293T C235(1.19)  LDD1633  [6]
 LDCM0430  CL40 HEK-293T C235(1.04)  LDD1634  [6]
 LDCM0443  CL52 HEK-293T C235(1.06)  LDD1646  [6]
 LDCM0456  CL64 HEK-293T C235(1.31)  LDD1659  [6]
 LDCM0469  CL76 HEK-293T C235(1.06)  LDD1672  [6]
 LDCM0482  CL88 HEK-293T C235(1.11)  LDD1685  [6]
 LDCM0616  Fragment61 Jurkat _(20.00)  LDD1489  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2) ATG8 family P60520
BAG family molecular chaperone regulator 3 (BAG3) . O95817

References

1 Design and synthesis of tailored human caseinolytic protease P inhibitors. Chem Commun (Camb). 2018 Aug 28;54(70):9833-9836. doi: 10.1039/c8cc05265d.
Mass spectrometry data entry: PXD010277
2 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
3 Proteome-wide covalent ligand discovery in native biological systems. Nature. 2016 Jun 23;534(7608):570-4. doi: 10.1038/nature18002. Epub 2016 Jun 15.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853