Details of the Target

General Information of Target

Target ID LDTP10419
Target Name Biorientation of chromosomes in cell division protein 1 (BOD1)
Gene Name BOD1
Gene ID 91272
Synonyms
FAM44B; Biorientation of chromosomes in cell division protein 1; Biorientation defective protein 1; Protein FAM44B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQ
PDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSD
FPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIIN
CGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHL
TDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGGPWIRGNVYIHPTAKVAPSAV
LGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDP
NPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
Target Bioclass
Other
Family
BOD1 family
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Function Required for proper chromosome biorientation through the detection or correction of syntelic attachments in mitotic spindles.
Uniprot ID
Q96IK1
Ensemble ID
ENST00000285908.5
HGNC ID
HGNC:25114

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCC1187 Insertion: p.H96delinsLIVQFPSMSENKN .
NCIH1792 Insertion: p.H96delinsPCVLIVQFPSMSENKN .
TCCSUP SNV: p.I52N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 13 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
TH211
 Probe Info  		Y82(10.38)  LDD0257  [2]
STPyne
 Probe Info  		K161(10.00)  LDD0277  [3]
JZ128-DTB
 Probe Info  		N.A.  LDD0462  [4]
BTD
 Probe Info  		C72(0.39)  LDD2091  [5]
Curcusone 37
 Probe Info  		2.05  LDD0188  [6]
AHL-Pu-1
 Probe Info  		C72(2.66)  LDD0169  [7]
HHS-465
 Probe Info  		Y82(3.69)  LDD2237  [8]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [9]
TFBX
 Probe Info  		N.A.  LDD0027  [9]
WYneO
 Probe Info  		N.A.  LDD0022  [10]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [11]
AOyne
 Probe Info  		15.00  LDD0443  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C72(2.16)  LDD0170  [7]
 LDCM0026  4SU-RNA+native RNA HEK-293T C72(2.66)  LDD0169  [7]
 LDCM0520  AKOS000195272 MDA-MB-231 C72(0.48)  LDD2113  [5]
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0498  BS-3668 MDA-MB-231 C72(0.39)  LDD2091  [5]
 LDCM0033  Curcusone1d MCF-7 2.05  LDD0188  [6]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [4]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C72(0.93)  LDD2102  [5]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C72(0.76)  LDD2092  [5]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C72(0.76)  LDD2096  [5]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C72(0.75)  LDD2098  [5]
 LDCM0508  Nucleophilic fragment 17a MDA-MB-231 C72(0.81)  LDD2101  [5]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C72(0.74)  LDD2104  [5]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C72(0.67)  LDD2108  [5]
 LDCM0521  Nucleophilic fragment 23b MDA-MB-231 C72(0.99)  LDD2114  [5]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C72(0.83)  LDD2116  [5]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C72(1.54)  LDD2118  [5]
 LDCM0527  Nucleophilic fragment 26b MDA-MB-231 C72(0.82)  LDD2120  [5]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C72(0.89)  LDD2122  [5]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C72(1.04)  LDD2124  [5]
 LDCM0541  Nucleophilic fragment 36 MDA-MB-231 C72(0.69)  LDD2134  [5]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C72(0.95)  LDD2135  [5]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C72(0.63)  LDD2141  [5]
 LDCM0552  Nucleophilic fragment 6a MDA-MB-231 C72(0.96)  LDD2146  [5]
 LDCM0554  Nucleophilic fragment 7a MDA-MB-231 C72(0.43)  LDD2148  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
S-adenosylmethionine synthase isoform type-2 (MAT2A) AdoMet synthase family P31153
Tryptophan 5-hydroxylase 1 (TPH1) Biopterin-dependent aromatic amino acid hydroxylase family P17752
Cathepsin B (CTSB) Peptidase C1 family P07858
Neuroendocrine convertase 2 (PCSK2) Peptidase S8 family P16519
E3 SUMO-protein ligase PIAS4 (PIAS4) PIAS family Q8N2W9
Pyruvate kinase PKM (PKM) Pyruvate kinase family P14618
Elongation factor 1-alpha 1 (EEF1A1) Classic translation factor GTPase family P68104
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-type proton ATPase subunit H (ATP6V1H) V-ATPase H subunit family Q9UI12
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calbindin (CALB1) Calbindin family P05937
Glypican-5 (GPC5) Glypican family P78333
BAG family molecular chaperone regulator 3 (BAG3) . O95817
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Total Synthesis and Target Identification of the Curcusone Diterpenes. J Am Chem Soc. 2021 Mar 24;143(11):4379-4386. doi: 10.1021/jacs.1c00557. Epub 2021 Mar 11.
7 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
8 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
9 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
10 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
11 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
12 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.