General Information of Target

Target ID LDTP07963
Target Name Fatty acid 2-hydroxylase (FA2H)
Gene Name FA2H
Gene ID 79152
Synonyms
FAAH; FAXDC1; Fatty acid 2-hydroxylase; EC 1.14.18.-; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain-containing protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA
DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD
KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV
LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM
KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV
FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH
TLTPEKPHLKTQ
Target Bioclass
Enzyme
Family
Sterol desaturase family, SCS7 subfamily
Subcellular location
Endoplasmic reticulum membrane
Function
Catalyzes the hydroxylation of free fatty acids at the C-2 position to produce 2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis. FA2H is stereospecific for the production of (R)-2-hydroxy fatty acids. Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath. Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier. Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifically regulating hair follicle homeostasis. Involved in the synthesis of sphingolipids of plasma membrane rafts, controlling lipid raft mobility and trafficking of raft-associated proteins.
Uniprot ID
Q7L5A8
Ensemble ID
ENST00000219368.8
HGNC ID
HGNC:21197
ChEMBL ID
CHEMBL4879483

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HDQP1 SNV: p.A21V .
MFE319 SNV: p.L318P .
MOLT4 SNV: p.G55C .
NUGC3 SNV: p.G298D .
RKO Deletion: p.A8PfsTer91 .
SKMEL28 SNV: p.H368N .
SNU308 SNV: p.S171C .
SW948 SNV: p.G217E .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C25(2.51)  LDD3472  [1]
IA-alkyne
 Probe Info 
N.A.  LDD0162  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
A-DA
 Probe Info 
2.22  LDD0142  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0083  Avasimibe A-549 2.12  LDD0143  [3]
 LDCM0082  FK866 A-549 2.22  LDD0142  [3]
 LDCM0022  KB02 ICC18 C25(1.93)  LDD2385  [1]
 LDCM0023  KB03 ICC18 C25(2.03)  LDD2802  [1]
 LDCM0024  KB05 TFK-1 C25(2.51)  LDD3472  [1]
 LDCM0084  Ro 48-8071 A-549 20.00  LDD0145  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Sphingosine-1-phosphate lyase 1 (SGPL1) Group II decarboxylase family O95470
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
E3 ubiquitin-protein ligase MARCHF8 (MARCHF8) . Q5T0T0
Macrophage scavenger receptor types I and II (MSR1) . P21757
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Erlin-1 (ERLIN1) Band 7/mec-2 family O75477
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Peroxisome assembly protein 12 (PEX12) Pex2/pex10/pex12 family O00623
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Transmembrane protein 41A (TMEM41A) TMEM41 family Q96HV5
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytoplasmic dynein 1 heavy chain 1 (DYNC1H1) Dynein heavy chain family Q14204
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Disks large homolog 2 (DLG2) MAGUK family Q15700
Synaptotagmin-2 (SYT2) Synaptotagmin family Q8N9I0

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 A Global Map of Lipid-Binding Proteins and Their Ligandability in Cells. Cell. 2015 Jun 18;161(7):1668-80. doi: 10.1016/j.cell.2015.05.045.