Details of the Target
General Information of Target
| Target ID | LDTP07963 | |||||
|---|---|---|---|---|---|---|
| Target Name | Fatty acid 2-hydroxylase (FA2H) | |||||
| Gene Name | FA2H | |||||
| Gene ID | 79152 | |||||
| Synonyms |
FAAH; FAXDC1; Fatty acid 2-hydroxylase; EC 1.14.18.-; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA
DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLTPEKPHLKTQ |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Sterol desaturase family, SCS7 subfamily
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Catalyzes the hydroxylation of free fatty acids at the C-2 position to produce 2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis. FA2H is stereospecific for the production of (R)-2-hydroxy fatty acids. Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath. Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies critical for skin permeability barrier. Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifically regulating hair follicle homeostasis. Involved in the synthesis of sphingolipids of plasma membrane rafts, controlling lipid raft mobility and trafficking of raft-associated proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C25(2.51) | LDD3472 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
A-DA Probe Info |
![]() |
2.22 | LDD0142 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0083 | Avasimibe | A-549 | 2.12 | LDD0143 | [3] |
| LDCM0082 | FK866 | A-549 | 2.22 | LDD0142 | [3] |
| LDCM0022 | KB02 | ICC18 | C25(1.93) | LDD2385 | [1] |
| LDCM0023 | KB03 | ICC18 | C25(2.03) | LDD2802 | [1] |
| LDCM0024 | KB05 | TFK-1 | C25(2.51) | LDD3472 | [1] |
| LDCM0084 | Ro 48-8071 | A-549 | 20.00 | LDD0145 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) | BZIP family | Q96BA8 | |||
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable G-protein coupled receptor 152 (GPR152) | G-protein coupled receptor 1 family | Q8TDT2 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| B-cell antigen receptor complex-associated protein alpha chain (CD79A) | . | P11912 | |||
Other
References



