Details of the Target
General Information of Target
| Target ID | LDTP07495 | |||||
|---|---|---|---|---|---|---|
| Target Name | Caveolae-associated protein 1 (CAVIN1) | |||||
| Gene Name | CAVIN1 | |||||
| Gene ID | 284119 | |||||
| Synonyms |
PTRF; Caveolae-associated protein 1; Cavin-1; Polymerase I and transcript release factor |
|||||
| 3D Structure | ||||||
| Sequence |
MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDK
IIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVN VKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPE KEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEK MEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKS FTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGD LRRGSSPDVHALLEITEESDAVLVDKSDSD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CAVIN family
|
|||||
| Subcellular location |
Membrane, caveola
|
|||||
| Function |
Plays an important role in caveolae formation and organization. Essential for the formation of caveolae in all tissues. Core component of the CAVIN complex which is essential for recruitment of the complex to the caveolae in presence of calveolin-1 (CAV1). Essential for normal oligomerization of CAV1. Promotes ribosomal transcriptional activity in response to metabolic challenges in the adipocytes and plays an important role in the formation of the ribosomal transcriptional loop. Dissociates transcription complexes paused by DNA-bound TTF1, thereby releasing both RNA polymerase I and pre-RNA from the template. The caveolae biogenesis pathway is required for the secretion of proteins such as GASK1A.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
P8 Probe Info |
![]() |
10.00 | LDD0451 | [1] | |
|
AZ-9 Probe Info |
![]() |
10.00 | LDD0393 | [2] | |
|
ONAyne Probe Info |
![]() |
K122(10.00); K136(2.22); K165(0.62); K170(0.75) | LDD0274 | [3] | |
|
STPyne Probe Info |
![]() |
K109(5.26); K113(7.93); K116(7.63); K122(6.14) | LDD0277 | [3] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K137(3.08); K276(4.10); K260(4.28); K265(4.28) | LDD3494 | [4] | |
|
5E-2FA Probe Info |
![]() |
H100(0.00); H305(0.00) | LDD2235 | [5] | |
|
m-APA Probe Info |
![]() |
H100(0.00); H305(0.00) | LDD2231 | [5] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ILS-1 PP Probe Info |
![]() |
3.96 | LDD0417 | [7] | |
|
FFF probe11 Probe Info |
![]() |
6.99 | LDD0472 | [8] | |
|
FFF probe13 Probe Info |
![]() |
7.49 | LDD0476 | [8] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Histone acetyltransferase KAT5 (KAT5) | MYST (SAS/MOZ) family | Q92993 | |||
Transporter and channel
Transcription factor
Other
References











