Details of the Target

General Information of Target

Target ID LDTP07495
Target Name Caveolae-associated protein 1 (CAVIN1)
Gene Name CAVIN1
Gene ID 284119
Synonyms
PTRF; Caveolae-associated protein 1; Cavin-1; Polymerase I and transcript release factor
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDK
IIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVN
VKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPE
KEGEELGEGERPEEDAAALELSSDEAVEVEEVIEESRAERIKRSGLRRVDDFKKAFSKEK
MEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKS
FTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDEGGAERGEAGD
LRRGSSPDVHALLEITEESDAVLVDKSDSD
Target Bioclass
Other
Family
CAVIN family
Subcellular location
Membrane, caveola
Function
Plays an important role in caveolae formation and organization. Essential for the formation of caveolae in all tissues. Core component of the CAVIN complex which is essential for recruitment of the complex to the caveolae in presence of calveolin-1 (CAV1). Essential for normal oligomerization of CAV1. Promotes ribosomal transcriptional activity in response to metabolic challenges in the adipocytes and plays an important role in the formation of the ribosomal transcriptional loop. Dissociates transcription complexes paused by DNA-bound TTF1, thereby releasing both RNA polymerase I and pre-RNA from the template. The caveolae biogenesis pathway is required for the secretion of proteins such as GASK1A.
Uniprot ID
Q6NZI2
Ensemble ID
ENST00000357037.6
HGNC ID
HGNC:9688

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A172 SNV: p.Q157H .
HCC1937 SNV: p.P14T .
JURKAT SNV: p.R220C .
KMRC1 SNV: p.T339S .
MOLT4 Deletion: p.A64PfsTer2
SNV: p.A218V;p.D347Y		 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
P8
 Probe Info  		10.00  LDD0451  [1]
AZ-9
 Probe Info  		10.00  LDD0393  [2]
ONAyne
 Probe Info  		K122(10.00); K136(2.22); K165(0.62); K170(0.75)  LDD0274  [3]
STPyne
 Probe Info  		K109(5.26); K113(7.93); K116(7.63); K122(6.14)  LDD0277  [3]
OPA-S-S-alkyne
 Probe Info  		K137(3.08); K276(4.10); K260(4.28); K265(4.28)  LDD3494  [4]
5E-2FA
 Probe Info  		H100(0.00); H305(0.00)  LDD2235  [5]
m-APA
 Probe Info  		H100(0.00); H305(0.00)  LDD2231  [5]
Acrolein
 Probe Info  		N.A.  LDD0217  [6]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
ILS-1 PP
 Probe Info  		3.96  LDD0417  [7]
FFF probe11
 Probe Info  		6.99  LDD0472  [8]
FFF probe13
 Probe Info  		7.49  LDD0476  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H324(0.00); H100(0.00)  LDD0222  [6]
 LDCM0107  IAA HeLa H324(0.00); H100(0.00)  LDD0221  [6]
 LDCM0109  NEM HeLa H324(0.00); H100(0.00)  LDD0223  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Caveolin-1 (CAV1) Caveolin family Q03135
Caveolin-3 (CAV3) Caveolin family P56539
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Sperm protein associated with the nucleus on the X chromosome N2 (SPANXN2) SPAN-X family Q5MJ10
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) Krueppel C2H2-type zinc-finger protein family Q9Y5A6
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Caveolae-associated protein 1 (CAVIN1) CAVIN family Q6NZI2
Caveolae-associated protein 2 (CAVIN2) CAVIN family O95810
Caveolae-associated protein 3 (CAVIN3) CAVIN family Q969G5
Large ribosomal subunit protein mL45 (MRPL45) Mitochondrion-specific ribosomal protein mL45 family Q9BRJ2
Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3) SPAN-X family Q5MJ09
Tumor necrosis factor alpha-induced protein 8-like protein 1 (TNFAIP8L1) TNFAIP8 family Q8WVP5
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Deoxynucleotidyltransferase terminal-interacting protein 2 (DNTTIP2) . Q5QJE6
F-box only protein 28 (FBXO28) . Q9NVF7
INO80 complex subunit B (INO80B) . Q9C086
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Tetratricopeptide repeat protein 5 (TTC5) . Q8N0Z6
Zinc finger CCHC domain-containing protein 10 (ZCCHC10) . Q8TBK6

References

1 Comparison of Different Competitive Proteome Profiling Approaches in Target Identification of Covalent Inhibitors. Chembiochem. 2022 Dec 16;23(24):e202200389. doi: 10.1002/cbic.202200389. Epub 2022 Nov 22.
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
5 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
6 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
7 A Chemical Proteomic Analysis of Illudin-Interacting Proteins. Chemistry. 2019 Sep 25;25(54):12644-12651. doi: 10.1002/chem.201902919. Epub 2019 Sep 3.
Mass spectrometry data entry: PXD014175
8 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.