Details of the Target

General Information of Target

Target ID LDTP07287
Target Name KN motif and ankyrin repeat domain-containing protein 2 (KANK2)
Gene Name KANK2
Gene ID 25959
Synonyms
ANKRD25; KIAA1518; MXRA3; SIP; KN motif and ankyrin repeat domain-containing protein 2; Ankyrin repeat domain-containing protein 25; Matrix-remodeling-associated protein 3; SRC-1-interacting protein; SIP; SRC-interacting protein; SRC1-interacting protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLR
RVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGF
NPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPP
SAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPT
AGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
QELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAPAQRAQSLEPY
GTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVR
SIMKRKEEVADPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPS
VAEAPQLRPAGTAAAKTSRQECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLA
LEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLDYVV
NIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIE
TVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCAC
EHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD
DESPTSSSAEE
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Involved in transcription regulation by sequestering in the cytoplasm nuclear receptor coactivators such as NCOA1, NCOA2 and NCOA3. Involved in regulation of caspase-independent apoptosis by sequestering the proapoptotic factor AIFM1 in mitochondria. Pro-apoptotic stimuli can induce its proteasomal degradation allowing the translocation of AIFM1 to the nucleus to induce apoptosis. Involved in the negative control of vitamin D receptor signaling pathway. Involved in actin stress fibers formation through its interaction with ARHGDIA and the regulation of the Rho signaling pathway. May thereby play a role in cell adhesion and migration, regulating for instance podocytes migration during development of the kidney. Through the Rho signaling pathway may also regulate cell proliferation.
Uniprot ID
Q63ZY3
Ensemble ID
ENST00000586659.6
HGNC ID
HGNC:29300

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAOV3 SNV: p.Q307E DBIA    Probe Info 
HCT15 SNV: p.R224W .
HEC1 SNV: p.Q229Ter; p.L418I DBIA    Probe Info 
HEC1B SNV: p.Q229Ter .
JURKAT SNV: p.A636T .
KATOIII SNV: p.T612I DBIA    Probe Info 
MDAMB436 SNV: p.E487V DBIA    Probe Info 
MFE319 SNV: p.Y360Ter DBIA    Probe Info 
MM1S SNV: p.L148M .
MOLT4 SNV: p.Y32Ter .
NCIH446 SNV: p.A779S .
SKMEL30 SNV: p.E561Ter DBIA    Probe Info 
SNU1 SNV: p.P448S DBIA    Probe Info 
SW1116 SNV: p.E851D DBIA    Probe Info 
SW403 SNV: p.A700D DBIA    Probe Info 
TOV21G SNV: p.R828S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
BTD
 Probe Info  		C562(1.91)  LDD2099  [2]
AHL-Pu-1
 Probe Info  		C389(2.46)  LDD0171  [3]
DBIA
 Probe Info  		C562(5.20)  LDD0209  [4]
IA-alkyne
 Probe Info  		C103(1.46)  LDD2187  [5]
NAIA_4
 Probe Info  		C88(0.00); C103(0.00); C389(0.00); C412(0.00)  LDD2226  [6]
NAIA_5
 Probe Info  		N.A.  LDD2224  [6]
IPM
 Probe Info  		C562(0.00); C412(0.00); C103(0.00)  LDD0147  [7]
TFBX
 Probe Info  		N.A.  LDD0148  [7]
Acrolein
 Probe Info  		N.A.  LDD0217  [8]
Methacrolein
 Probe Info  		N.A.  LDD0218  [8]
AOyne
 Probe Info  		9.40  LDD0443  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA DM93 C389(2.46)  LDD0171  [3]
 LDCM0237  AC12 HEK-293T C562(1.02)  LDD1510  [10]
 LDCM0280  AC20 HEK-293T C562(0.95)  LDD1519  [10]
 LDCM0284  AC24 HEK-293T C562(1.26)  LDD1523  [10]
 LDCM0288  AC28 HEK-293T C562(0.81)  LDD1527  [10]
 LDCM0293  AC32 HEK-293T C562(1.28)  LDD1532  [10]
 LDCM0297  AC36 HEK-293T C562(0.82)  LDD1536  [10]
 LDCM0301  AC4 HEK-293T C562(0.94)  LDD1540  [10]
 LDCM0302  AC40 HEK-293T C562(1.11)  LDD1541  [10]
 LDCM0306  AC44 HEK-293T C562(0.93)  LDD1545  [10]
 LDCM0310  AC48 HEK-293T C562(1.06)  LDD1549  [10]
 LDCM0315  AC52 HEK-293T C562(1.12)  LDD1554  [10]
 LDCM0319  AC56 HEK-293T C562(1.21)  LDD1558  [10]
 LDCM0324  AC60 HEK-293T C562(1.08)  LDD1563  [10]
 LDCM0328  AC64 HEK-293T C562(1.48)  LDD1567  [10]
 LDCM0345  AC8 HEK-293T C562(0.93)  LDD1569  [10]
 LDCM0275  AKOS034007705 HEK-293T C562(0.87)  LDD1514  [10]
 LDCM0390  CL12 HEK-293T C562(0.92)  LDD1594  [10]
 LDCM0408  CL20 HEK-293T C562(0.81)  LDD1612  [10]
 LDCM0412  CL24 HEK-293T C562(1.15)  LDD1616  [10]
 LDCM0421  CL32 HEK-293T C562(0.86)  LDD1625  [10]
 LDCM0425  CL36 HEK-293T C562(1.01)  LDD1629  [10]
 LDCM0434  CL44 HEK-293T C562(0.93)  LDD1638  [10]
 LDCM0438  CL48 HEK-293T C562(1.28)  LDD1642  [10]
 LDCM0447  CL56 HEK-293T C562(1.14)  LDD1650  [10]
 LDCM0452  CL60 HEK-293T C562(1.10)  LDD1655  [10]
 LDCM0460  CL68 HEK-293T C562(0.89)  LDD1663  [10]
 LDCM0465  CL72 HEK-293T C562(0.86)  LDD1668  [10]
 LDCM0473  CL8 HEK-293T C562(1.01)  LDD1676  [10]
 LDCM0474  CL80 HEK-293T C562(0.87)  LDD1677  [10]
 LDCM0478  CL84 HEK-293T C562(1.15)  LDD1681  [10]
 LDCM0487  CL92 HEK-293T C562(1.00)  LDD1690  [10]
 LDCM0491  CL96 HEK-293T C562(0.83)  LDD1694  [10]
 LDCM0625  F8 Ramos C103(1.46)  LDD2187  [5]
 LDCM0573  Fragment11 Ramos C103(20.00)  LDD2190  [5]
 LDCM0574  Fragment12 Ramos C88(1.51)  LDD2191  [5]
 LDCM0575  Fragment13 Ramos C88(0.99)  LDD2192  [5]
 LDCM0580  Fragment21 Ramos C88(0.95)  LDD2195  [5]
 LDCM0582  Fragment23 Ramos C88(0.72)  LDD2196  [5]
 LDCM0578  Fragment27 Ramos C88(0.83)  LDD2197  [5]
 LDCM0586  Fragment28 Ramos C103(1.02); C88(0.52)  LDD2198  [5]
 LDCM0588  Fragment30 Ramos C88(1.08)  LDD2199  [5]
 LDCM0589  Fragment31 Ramos C88(0.84)  LDD2200  [5]
 LDCM0468  Fragment33 Ramos C88(0.90)  LDD2202  [5]
 LDCM0596  Fragment38 Ramos C88(1.33)  LDD2203  [5]
 LDCM0610  Fragment52 Ramos C88(1.10)  LDD2204  [5]
 LDCM0614  Fragment56 Ramos C88(0.92)  LDD2205  [5]
 LDCM0022  KB02 HEK-293T C562(0.73)  LDD1492  [10]
 LDCM0023  KB03 Jurkat C562(5.20)  LDD0209  [4]
 LDCM0024  KB05 COLO792 C570(2.57)  LDD3310  [11]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C562(1.91)  LDD2099  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 29 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein arginine N-methyltransferase 5 (PRMT5) Protein arginine N-methyltransferase family O14744
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Bifunctional polynucleotide phosphatase/kinase (PNKP) DNA 3' phosphatase family Q96T60
Apoptosis-inducing factor 1, mitochondrial (AIFM1) FAD-dependent oxidoreductase family O95831
Baculoviral IAP repeat-containing protein 7 (BIRC7) IAP family Q96CA5
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Proteasome subunit beta type-4 (PSMB4) Peptidase T1B family P28070
Serine/threonine-protein phosphatase PP1-beta catalytic subunit (PPP1CB) PPP phosphatase family P62140
Tribbles homolog 3 (TRIB3) CAMK Ser/Thr protein kinase family Q96RU7
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Cyclin-dependent kinase-like 3 (CDKL3) CMGC Ser/Thr protein kinase family Q8IVW4
Pterin-4-alpha-carbinolamine dehydratase (PCBD1) Pterin-4-alpha-carbinolamine dehydratase family P61457
RanBP-type and C3HC4-type zinc finger-containing protein 1 (RBCK1) RBR family Q9BYM8
Exosome complex component RRP43 (EXOSC8) RNase PH family Q96B26
E3 ubiquitin-protein ligase RNF8 (RNF8) RNF8 family O76064
Rho-related GTP-binding protein RhoH (RHOH) Rho family Q15669
Nuclear receptor coactivator 1 (NCOA1) SRC/p160 nuclear receptor coactivator family Q15788
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Guanine nucleotide-binding protein-like 3-like protein (GNL3L) TRAFAC class YlqF/YawG GTPase family Q9NVN8
Protein-glutamine gamma-glutamyltransferase 5 (TGM5) Transglutaminase family O43548
DNA topoisomerase 3-beta-1 (TOP3B) Type IA topoisomerase family O95985
Germ cell-less protein-like 1 (GMCL1) . Q96IK5
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
RalA-binding protein 1 (RALBP1) . Q15311
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Copper homeostasis protein cutC homolog (CUTC) CutC family Q9NTM9
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
SH3 and cysteine-rich domain-containing protein (STAC) . Q99469
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cell division cycle 5-like protein (CDC5L) CEF1 family Q99459
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein 212 (ZNF212) Krueppel C2H2-type zinc-finger protein family Q9UDV6
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 512 (ZNF512) Krueppel C2H2-type zinc-finger protein family Q96ME7
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein 784 (ZNF784) Krueppel C2H2-type zinc-finger protein family Q8NCA9
Zinc finger protein PLAGL1 (PLAGL1) Krueppel C2H2-type zinc-finger protein family Q9UM63
Zinc finger protein PLAGL2 (PLAGL2) Krueppel C2H2-type zinc-finger protein family Q9UPG8
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
Paired box protein Pax-6 (PAX6) Paired homeobox family P26367
THAP domain-containing protein 1 (THAP1) THAP1 family Q9NVV9
Golgin-45 (BLZF1) . Q9H2G9
Homeobox protein MOX-1 (MEOX1) . P50221
LIM/homeobox protein Lhx1 (LHX1) . P48742
THAP domain-containing protein 6 (THAP6) . Q8TBB0
Transcription factor LBX1 (LBX1) . P52954
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) CEA family P40199
Other
Click To Hide/Show 98 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Ankyrin repeat and SOCS box protein 15 (ASB15) Ankyrin SOCS box (ASB) family Q8WXK1
BLOC-1-related complex subunit 6 (BORCS6) BORCS6 family Q96GS4
cAMP-dependent protein kinase type I-beta regulatory subunit (PRKAR1B) CAMP-dependent kinase regulatory chain family P31321
Coiled-coil domain-containing protein 88B (CCDC88B) CCDC88 family A6NC98
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Cilia- and flagella-associated protein 68 (CFAP68) CFAP68 family Q9H5F2
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
Cyclin-dependent kinase 2-interacting protein (CINP) CINP family Q9BW66
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Dynein light chain 1, cytoplasmic (DYNLL1) Dynein light chain family P63167
Dynein light chain 2, cytoplasmic (DYNLL2) Dynein light chain family Q96FJ2
Activator of basal transcription 1 (ABT1) ESF2/ABP1 family Q9ULW3
Eukaryotic translation initiation factor 4E (EIF4E) Eukaryotic initiation factor 4E family P06730
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
GAS2-like protein 2 (GAS2L2) GAS2 family Q8NHY3
Geminin (GMNN) Geminin family O75496
G kinase-anchoring protein 1 (GKAP1) GKAP1 family Q5VSY0
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Golgin subfamily A member 6A (GOLGA6A) GOLGA6 family Q9NYA3
Homer protein homolog 3 (HOMER3) Homer family Q9NSC5
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
MICOS complex subunit MIC19 (CHCHD3) MICOS complex subunit Mic19 family Q9NX63
Protein Mis18-beta (OIP5) Mis18 family O43482
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Meiosis-specific nuclear structural protein 1 (MNS1) MNS1 family Q8NEH6
MOB kinase activator 1A (MOB1A) MOB1/phocein family Q9H8S9
MOB kinase activator 3C (MOB3C) MOB1/phocein family Q70IA8
G-patch domain and KOW motifs-containing protein (GPKOW) MOS2 family Q92917
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
Testis-specific Y-encoded-like protein 6 (TSPYL6) Nucleosome assembly protein (NAP) family Q8N831
Prefoldin subunit 6 (PFDN6) Prefoldin subunit beta family O15212
Proline-rich protein 5-like (PRR5L) PROTOR family Q6MZQ0
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Negative elongation factor E (NELFE) RRM NELF-E family P18615
Disks large-associated protein 3 (DLGAP3) SAPAP family O95886
Heat shock protein beta-2 (HSPB2) Small heat shock protein (HSP20) family Q16082
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Alpha-taxilin (TXLNA) Taxilin family P40222
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
TRAF-interacting protein with FHA domain-containing protein A (TIFA) TIFA family Q96CG3
UPF0561 protein C2orf68 (C2orf68) UPF0561 family Q2NKX9
U3 small nucleolar RNA-associated protein 14 homolog C (UTP14C) UTP14 family Q5TAP6
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Zinc finger HIT domain-containing protein 1 (ZNHIT1) ZNHIT1 family O43257
ARL14 effector protein (ARL14EP) . Q8N8R7
Brorin (VWC2) . Q2TAL6
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Centrosomal protein of 55 kDa (CEP55) . Q53EZ4
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Chromobox protein homolog 8 (CBX8) . Q9HC52
Cytohesin-4 (CYTH4) . Q9UIA0
DPEP2 neighbor protein (DPEP2NB) . A0A0U1RQF7
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6
Elongin-A (ELOA) . Q14241
Four and a half LIM domains protein 2 (FHL2) . Q14192
Four and a half LIM domains protein 3 (FHL3) . Q13643
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
Gem-associated protein 4 (GEMIN4) . P57678
Heat shock factor 2-binding protein (HSF2BP) . O75031
INO80 complex subunit B (INO80B) . Q9C086
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
Kinesin-associated protein 3 (KIFAP3) . Q92845
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM domain transcription factor LMO4 (LMO4) . P61968
Melanoma-associated antigen B4 (MAGEB4) . O15481
Microspherule protein 1 (MCRS1) . Q96EZ8
MIT domain-containing protein 1 (MITD1) . Q8WV92
Mitochondrial coiled-coil domain protein 1 (MCCD1) . P59942
MORN repeat-containing protein 3 (MORN3) . Q6PF18
PDZ and LIM domain protein 7 (PDLIM7) . Q9NR12
Pleckstrin homology domain-containing family A member 2 (PLEKHA2) . Q9HB19
Proline-serine-threonine phosphatase-interacting protein 1 (PSTPIP1) . O43586
Putative protein MSS51 homolog, mitochondrial (MSS51) . Q4VC12
Rab11 family-interacting protein 2 (RAB11FIP2) . Q7L804
Rhombotin-1 (LMO1) . P25800
Rhombotin-2 (LMO2) . P25791
SERTA domain-containing protein 3 (SERTAD3) . Q9UJW9
Tax1-binding protein 1 (TAX1BP1) . Q86VP1
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
TNF receptor-associated factor 1 (TRAF1) . Q13077
Ubiquitin-associated protein 2 (UBAP2) . Q5T6F2
Vimentin-type intermediate filament-associated coiled-coil protein (VMAC) . Q2NL98
Vinexin (SORBS3) . O60504
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0
Zinc finger MYND domain-containing protein 12 (ZMYND12) . Q9H0C1

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
4 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
5 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
9 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
10 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
11 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840