Details of the Target
General Information of Target
Target ID | LDTP06627 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H2A type 2-C (H2AC20) | |||||
Gene Name | H2AC20 | |||||
Gene ID | 8338 | |||||
Synonyms |
H2AFQ; HIST2H2AC; Histone H2A type 2-C; H2A-clustered histone 20; Histone H2A-GL101; Histone H2A/q |
|||||
3D Structure | ||||||
Sequence |
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H2A family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TH211 Probe Info |
![]() |
Y58(13.64) | LDD0260 | [1] | |
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
N1 Probe Info |
![]() |
E57(0.00); M52(0.00); Y51(0.00) | LDD0245 | [3] | |
aONE Probe Info |
![]() |
N.A. | LDD0002 | [4] | |
SF Probe Info |
![]() |
K10(0.00); K119(0.00); K100(0.00); Y40(0.00) | LDD0028 | [5] | |
STPyne Probe Info |
![]() |
K119(0.00); K120(0.00); K96(0.00) | LDD0009 | [4] | |
1c-yne Probe Info |
![]() |
K96(0.00); K100(0.00) | LDD0228 | [6] | |
Acrolein Probe Info |
![]() |
H83(0.00); K119(0.00) | LDD0217 | [7] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [7] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [7] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
FFF probe13 Probe Info |
![]() |
5.39 | LDD0475 | [8] | |
BD-F Probe Info |
![]() |
T60(0.00); L64(0.00); E62(0.00); A61(0.00) | LDD0024 | [9] | |
LD-F Probe Info |
![]() |
E57(0.00); Y58(0.00); E62(0.00); L59(0.00) | LDD0015 | [9] | |
TM-F Probe Info |
![]() |
T60(0.00); L59(0.00); L64(0.00); I63(0.00) | LDD0020 | [9] |
Competitor(s) Related to This Target
References