General Information of Target

Target ID LDTP06608
Target Name Cytochrome P450 1B1 (CYP1B1)
Gene Name CYP1B1
Gene ID 1545
Synonyms
Cytochrome P450 1B1; EC 1.14.14.1; CYPIB1; Hydroperoxy icosatetraenoate dehydratase; EC 4.2.1.152
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Cytochrome P450 family
Subcellular location
Endoplasmic reticulum membrane
Function
A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Exhibits catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2- and 4-hydroxy E1 and E2. Displays a predominant hydroxylase activity toward E2 at the C-4 position. Metabolizes testosterone and progesterone to B or D ring hydroxylated metabolites. May act as a major enzyme for all-trans retinoic acid biosynthesis in extrahepatic tissues. Catalyzes two successive oxidative transformation of all-trans retinol to all-trans retinal and then to the active form all-trans retinoic acid. Catalyzes the epoxidation of double bonds of certain PUFA. Converts arachidonic acid toward epoxyeicosatrienoic acid (EpETrE) regioisomers, 8,9-, 11,12-, and 14,15- EpETrE, that function as lipid mediators in the vascular system. Additionally, displays dehydratase activity toward oxygenated eicosanoids hydroperoxyeicosatetraenoates (HpETEs). This activity is independent of cytochrome P450 reductase, NADPH, and O2. Also involved in the oxidative metabolism of xenobiotics, particularly converting polycyclic aromatic hydrocarbons and heterocyclic aryl amines procarcinogens to DNA-damaging products. Plays an important role in retinal vascular development. Under hyperoxic O2 conditions, promotes retinal angiogenesis and capillary morphogenesis, likely by metabolizing the oxygenated products generated during the oxidative stress. Also, contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression.
TTD ID
T92521
Uniprot ID
Q16678
DrugMap ID
TTI84H7
Ensemble ID
ENST00000490576.2
HGNC ID
HGNC:2597
ChEMBL ID
CHEMBL4878

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C92(1.65)  LDD3310  [1]
JZ128-DTB
 Probe Info 
N.A.  LDD0462  [2]
THZ1-DTB
 Probe Info 
C92(1.73)  LDD0460  [2]
Jackson_14
 Probe Info 
3.57  LDD0123  [3]
NAIA_5
 Probe Info 
C280(20.00)  LDD2227  [4]
Acrolein
 Probe Info 
H279(0.00); C280(0.00)  LDD0222  [5]
JW-RF-010
 Probe Info 
N.A.  LDD0026  [6]
TFBX
 Probe Info 
N.A.  LDD0027  [6]
IPM
 Probe Info 
C280(0.00); C92(0.00)  LDD0147  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H279(0.00); C280(0.00)  LDD0222  [5]
 LDCM0632  CL-Sc Hep-G2 C280(20.00)  LDD2227  [4]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [2]
 LDCM0022  KB02 A2780 C280(2.16); C92(2.35)  LDD2254  [1]
 LDCM0023  KB03 786-O C280(1.69)  LDD2664  [1]
 LDCM0024  KB05 COLO792 C92(1.65)  LDD3310  [1]
 LDCM0016  Ranjitkar_cp1 MDA-MB-231 3.57  LDD0123  [3]
 LDCM0021  THZ1 HeLa S3 C92(1.73)  LDD0460  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Angiopoietin-1 receptor (TEK) Tyr protein kinase family Q02763

The Drug(s) Related To This Target

Approved
Click To Hide/Show 42 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Amodiaquine Small molecular drug DB00613
Betamethasone Small molecular drug DB00443
Biotin Small molecular drug DB00121
Budesonide Small molecular drug DB01222
Caffeine Small molecular drug DB00201
Cannabidiol Small molecular drug DB09061
Dasatinib Small molecular drug DB01254
Daunorubicin Small molecular drug DB00694
Docetaxel Small molecular drug DB01248
Doxorubicin Small molecular drug DB00997
Dronabinol Small molecular drug DB00470
Erlotinib Small molecular drug DB00530
Estradiol Small molecular drug DB00783
Estradiol Acetate Small molecular drug DB13952
Estradiol Cypionate Small molecular drug DB13954
Estradiol Valerate Small molecular drug DB13956
Estrone Small molecular drug DB00655
Flavone Small molecular drug DB07776
Flutamide Small molecular drug DB00499
Ginkgo Biloba Small molecular drug DB01381
Hydrocortisone Small molecular drug DB00741
Isoprenaline Small molecular drug DB01064
Ketoconazole Small molecular drug DB01026
Lansoprazole Small molecular drug DB00448
Melatonin Small molecular drug DB01065
Menadione Small molecular drug DB00170
Methylprednisolone Small molecular drug DB00959
Mitoxantrone Small molecular drug DB01204
Omeprazole Small molecular drug DB00338
Paclitaxel Small molecular drug DB01229
Prednisone Small molecular drug DB00635
Primaquine Small molecular drug DB01087
Progesterone Small molecular drug DB00396
Propofol Small molecular drug DB00818
Tamoxifen Small molecular drug DB00675
Testosterone Small molecular drug DB00624
Testosterone Undecanoate Small molecular drug DB13946
Theophylline Small molecular drug DB00277
Estradiol Benzoate . DB13953
Estradiol Dienanthate . DB13955
Prednisolone Phosphate . DB14631
Triclocarban . DB11155
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pinocembrin Small molecular drug D0G5CS
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Naringenin Small molecular drug D02ABO
Investigative
Click To Hide/Show 26 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
2-methoxyestradiol Small molecular drug DB02342
2-[2-(3,5-dimethoxy-phenyl)-vinyl]-thiophene Small molecular drug D0Z1AL
3-[2-(3,5-dimethoxy-phenyl)-vinyl]-furan Small molecular drug D06VXW
4-[2-(3,5-dimethoxy-phenyl)-vinyl]-pyridine Small molecular drug D0T9IK
Acacetin Small molecular drug D0NS1S
Apigenin Small molecular drug D00RIX
Chrysin Small molecular drug D01UYI
Chrysoeriol Small molecular drug D01FGM
Diosmetin Small molecular drug D00RFY
Eriodictyol Small molecular drug D08AIJ
Galangin Small molecular drug D0Y7HG
Genistein Small molecular drug DB01645
Homoeriodictyol Small molecular drug D0CR8V
Isorhamnetin Small molecular drug D07YDN
Isosakutanetin Small molecular drug D01FJE
Kaempferide Small molecular drug D04DYO
Kaempferol Small molecular drug D0G3TK
N-(2,4-dimethoxy-phenyl)-3,5-dimethoxy-benzamide Small molecular drug D0J9OG
Nabiximols Small molecular drug DB14011
Naringenin Small molecular drug DB03467
Quercetin Small molecular drug DB04216
Resveratrol Small molecular drug DB02709
Tamarixetin Small molecular drug D06PZE
Trismethoxyresveratrol Small molecular drug D0O9NE
Beta-naphthoflavone . DB06732
Medical Cannabis . DB14009

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
3 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
6 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255