Details of the Target

General Information of Target

Target ID LDTP04442
Target Name Ubiquitin-conjugating enzyme E2 D1 (UBE2D1)
Gene Name UBE2D1
Gene ID 7321
Synonyms
SFT; UBC5A; UBCH5; UBCH5A; Ubiquitin-conjugating enzyme E2 D1; EC 2.3.2.23; (E3-independent) E2 ubiquitin-conjugating enzyme D1; EC 2.3.2.24; E2 ubiquitin-conjugating enzyme D1; Stimulator of Fe transport; SFT; UBC4/5 homolog; UbcH5; Ubiquitin carrier protein D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
Target Bioclass
Enzyme
Family
Ubiquitin-conjugating enzyme family
Subcellular location
Cytoplasm
Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.
Uniprot ID
P51668
Ensemble ID
ENST00000373910.9
HGNC ID
HGNC:12474
ChEMBL ID
CHEMBL4105766

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K133(4.94)  LDD0277  [1]
JZ128-DTB
 Probe Info  		N.A.  LDD0462  [2]
THZ1-DTB
 Probe Info  		C85(1.03)  LDD0460  [2]
BTD
 Probe Info  		C85(1.86)  LDD2090  [3]
AHL-Pu-1
 Probe Info  		C85(11.17)  LDD0170  [4]
DBIA
 Probe Info  		C111(0.96)  LDD1492  [5]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [6]
IA-alkyne
 Probe Info  		C107(0.00); C85(0.00)  LDD0165  [7]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [6]
IPM
 Probe Info  		N.A.  LDD0025  [8]
TFBX
 Probe Info  		N.A.  LDD0027  [8]
NAIA_5
 Probe Info  		N.A.  LDD2223  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C85(1.02)  LDD2117  [3]
 LDCM0025  4SU-RNA DM93 C85(11.17)  LDD0170  [4]
 LDCM0026  4SU-RNA+native RNA DM93 C85(2.91)  LDD0171  [4]
 LDCM0179  JZ128 PC-3 N.A.  LDD0462  [2]
 LDCM0022  KB02 HEK-293T C111(0.96)  LDD1492  [5]
 LDCM0023  KB03 HEK-293T C111(1.02)  LDD1497  [5]
 LDCM0024  KB05 HEK-293T C111(1.11)  LDD1502  [5]
 LDCM0509  N-(4-bromo-3,5-dimethylphenyl)-2-nitroacetamide MDA-MB-231 C85(1.50)  LDD2102  [3]
 LDCM0497  Nucleophilic fragment 11b MDA-MB-231 C85(1.86)  LDD2090  [3]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C85(1.18)  LDD2092  [3]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C85(1.08)  LDD2098  [3]
 LDCM0532  Nucleophilic fragment 29a MDA-MB-231 C85(0.89)  LDD2125  [3]
 LDCM0543  Nucleophilic fragment 38 MDA-MB-231 C85(1.18)  LDD2136  [3]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C85(0.80)  LDD2137  [3]
 LDCM0559  Nucleophilic fragment 9b MDA-MB-231 C85(3.28)  LDD2153  [3]
 LDCM0021  THZ1 HeLa S3 C85(1.03)  LDD0460  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 29 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transitional endoplasmic reticulum ATPase (VCP) AAA ATPase family P55072
E3 ubiquitin-protein ligase Arkadia (RNF111) Arkadia family Q6ZNA4
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Probable E3 ubiquitin-protein ligase DTX3 (DTX3) Deltex family Q8N9I9
E3 ubiquitin-protein ligase XIAP (XIAP) IAP family P98170
Ubiquitin thioesterase OTUB1 (OTUB1) Peptidase C65 family Q96FW1
E3 ubiquitin-protein ligase RNF14 (RNF14) RBR family Q9UBS8
E3 ubiquitin-protein ligase RNF181 (RNF181) RNF181 family Q9P0P0
E3 ubiquitin-protein ligase RNF5 (RNF5) RNF5 family Q99942
TNF receptor-associated factor 6 (TRAF6) TNF receptor-associated factor family Q9Y4K3
E3 ubiquitin-protein ligase Midline-1 (MID1) TRIM/RBCC family O15344
E3 ubiquitin-protein ligase TRIM39 (TRIM39) TRIM/RBCC family Q9HCM9
E3 ubiquitin-protein ligase TRIM50 (TRIM50) TRIM/RBCC family Q86XT4
E3 ubiquitin-protein ligase TRIM62 (TRIM62) TRIM/RBCC family Q9BVG3
E3 ubiquitin-protein ligase TRIM8 (TRIM8) TRIM/RBCC family Q9BZR9
Tripartite motif-containing protein 3 (TRIM3) TRIM/RBCC family O75382
E3 ubiquitin-protein ligase makorin-1 (MKRN1) . Q9UHC7
E3 ubiquitin-protein ligase makorin-2 (MKRN2) . Q9H000
E3 ubiquitin-protein ligase RING1 (RING1) . Q06587
E3 ubiquitin-protein ligase RING2 (RNF2) . Q99496
E3 ubiquitin-protein ligase RNF115 (RNF115) . Q9Y4L5
E3 ubiquitin-protein ligase RNF126 (RNF126) . Q9BV68
E3 ubiquitin-protein ligase RNF182 (RNF182) . Q8N6D2
E3 ubiquitin-protein ligase RNF185 (RNF185) . Q96GF1
E3 ubiquitin-protein ligase RNF25 (RNF25) . Q96BH1
E3 ubiquitin-protein ligase ZNRF1 (ZNRF1) . Q8ND25
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Ubiquitin domain-containing protein 1 (UBTD1) . Q9HAC8
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Arrestin domain-containing protein 3 (ARRDC3) Arrestin family Q96B67
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (GNB2) WD repeat G protein beta family P62879
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
RING finger protein 11 (RNF11) . Q9Y3C5

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 A Chemoproteomic Strategy for Direct and Proteome-Wide Covalent Inhibitor Target-Site Identification. J Am Chem Soc. 2019 Jan 9;141(1):191-203. doi: 10.1021/jacs.8b07911. Epub 2018 Dec 20.
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
6 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264