General Information of Target

Target ID LDTP02913
Target Name Desmin (DES)
Gene Name DES
Gene ID 1674
Synonyms
Desmin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTS
GGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFA
NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVER
DNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLK
KVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKV
SDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEA
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPI
QTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Target Bioclass
Other
Family
Intermediate filament family
Subcellular location
Cytoplasm, myofibril, sarcomere, Z line
Function
Muscle-specific type III intermediate filament essential for proper muscular structure and function. Plays a crucial role in maintaining the structure of sarcomeres, inter-connecting the Z-disks and forming the myofibrils, linking them not only to the sarcolemmal cytoskeleton, but also to the nucleus and mitochondria, thus providing strength for the muscle fiber during activity. In adult striated muscle they form a fibrous network connecting myofibrils to each other and to the plasma membrane from the periphery of the Z-line structures. May act as a sarcomeric microtubule-anchoring protein: specifically associates with detyrosinated tubulin-alpha chains, leading to buckled microtubules and mechanical resistance to contraction. Required for nuclear membrane integrity, via anchoring at the cell tip and nuclear envelope, resulting in maintenance of microtubule-derived intracellular mechanical forces. Contributes to the transcriptional regulation of the NKX2-5 gene in cardiac progenitor cells during a short period of cardiomyogenesis and in cardiac side population stem cells in the adult. Plays a role in maintaining an optimal conformation of nebulette (NEB) on heart muscle sarcomeres to bind and recruit cardiac alpha-actin.
Uniprot ID
P17661
Ensemble ID
ENST00000373960.4
HGNC ID
HGNC:2770

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
ONAyne
 Probe Info 
K125(1.34)  LDD0274  [2]
STPyne
 Probe Info 
K240(10.00)  LDD0277  [2]
AZ-9
 Probe Info 
E413(0.78); E114(1.05); D117(1.11); E387(10.00)  LDD2208  [3]
DBIA
 Probe Info 
C333(1.82)  LDD3401  [4]
HHS-465
 Probe Info 
Y388(0.00); K407(0.00); K109(0.00)  LDD2240  [5]
PAL-AfBPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C238
 Probe Info 
17.15  LDD1911  [6]
C239
 Probe Info 
5.62  LDD1912  [6]
C390
 Probe Info 
28.44  LDD2049  [6]
C391
 Probe Info 
43.41  LDD2050  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 RD C333(1.76)  LDD2567  [4]
 LDCM0023  KB03 RD C333(1.48)  LDD2984  [4]
 LDCM0024  KB05 RD C333(1.82)  LDD3401  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
DNA-directed RNA polymerase II subunit RPB7 (POLR2G) Eukaryotic RPB7/RPC8 RNA polymerase subunit family P62487
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
Myotubularin (MTM1) Protein-tyrosine phosphatase family Q13496
E3 ubiquitin-protein ligase RNF4 (RNF4) . P78317
LON peptidase N-terminal domain and RING finger protein 3 (LONRF3) . Q496Y0
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Double homeobox protein 1 (DUX1) Paired homeobox family O43812
Double homeobox protein 4 (DUX4) Paired homeobox family Q9UBX2
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor LBX1 (LBX1) . P52954
Other
Click To Hide/Show 25 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
DNA mismatch repair protein Mlh1 (MLH1) DNA mismatch repair MutL/HexB family P40692
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Desmin (DES) Intermediate filament family P17661
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cytoskeletal 13 (KRT13) Intermediate filament family P13646
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Peripherin (PRPH) Intermediate filament family P41219
Vimentin (VIM) Intermediate filament family P08670
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Periplakin (PPL) Plakin or cytolinker family O60437
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
BAG family molecular chaperone regulator 5 (BAG5) . Q9UL15
Cancer/testis antigen 55 (CT55) . Q8WUE5
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM domain transcription factor LMO4 (LMO4) . P61968
Meiosis 1 arrest protein (M1AP) . Q8TC57
Phostensin (PPP1R18) . Q6NYC8

References

1 Labeling Preferences of Diazirines with Protein Biomolecules. J Am Chem Soc. 2021 May 5;143(17):6691-6700. doi: 10.1021/jacs.1c02509. Epub 2021 Apr 20.
Mass spectrometry data entry: PXD025140
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
6 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587