Details of the Target

General Information of Target

Target ID LDTP02322
Target Name U1 small nuclear ribonucleoprotein A (SNRPA)
Gene Name SNRPA
Gene ID 6626
Synonyms
U1 small nuclear ribonucleoprotein A; U1 snRNP A; U1-A; U1A
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK
EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA
TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI
PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Target Bioclass
Other
Family
RRM U1 A/B'' family
Subcellular location
Nucleus
Function
Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.
Uniprot ID
P09012
Ensemble ID
ENST00000243563.8
HGNC ID
HGNC:11151

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		8.28  LDD0066  [1]
STPyne
 Probe Info  		K122(10.00); K27(2.99); K276(9.75); K88(9.09)  LDD0277  [2]
ATP probe
 Probe Info  		K88(0.00); K122(0.00); K123(0.00)  LDD0199  [3]
m-APA
 Probe Info  		H10(0.00); H244(0.00)  LDD2233  [4]
1d-yne
 Probe Info  		N.A.  LDD0356  [5]
NHS
 Probe Info  		K96(0.00); K276(0.00)  LDD0010  [6]
SF
 Probe Info  		K123(0.00); K122(0.00)  LDD0028  [7]
YN-1
 Probe Info  		N.A.  LDD0446  [8]
1c-yne
 Probe Info  		N.A.  LDD0228  [5]
Acrolein
 Probe Info  		N.A.  LDD0217  [9]
HHS-482
 Probe Info  		Y78(0.80)  LDD2239  [10]
PAL-AfBPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe13
 Probe Info  		20.00  LDD0475  [11]
FFF probe14
 Probe Info  		17.44  LDD0477  [11]
VE-P
 Probe Info  		N.A.  LDD0396  [12]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H10(0.00); H244(0.00)  LDD0222  [9]
 LDCM0107  IAA HeLa H244(0.00); H10(0.00)  LDD0221  [9]
 LDCM0109  NEM HeLa N.A.  LDD0223  [9]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Spliceosome RNA helicase DDX39B (DDX39B) DEAD box helicase family Q13838
eEF1A lysine and N-terminal methyltransferase (METTL13) Methyltransferase superfamily Q8N6R0
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Telomerase RNA component interacting RNase (TRIR) . Q9BQ61
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
LIM/homeobox protein Lhx4 (LHX4) . Q969G2
Splicing factor, proline- and glutamine-rich (SFPQ) . P23246
Other
Click To Hide/Show 27 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
GRB10-interacting GYF protein 1 (GIGYF1) GIGYF family O75420
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
U1 small nuclear ribonucleoprotein A (SNRPA) RRM U1 A/B'' family P09012
Splicing factor U2AF 65 kDa subunit (U2AF2) Splicing factor SR family P26368
Tumor necrosis factor alpha-induced protein 8-like protein 1 (TNFAIP8L1) TNFAIP8 family Q8WVP5
U2 small nuclear ribonucleoprotein A' (SNRPA1) U2 small nuclear ribonucleoprotein A family P09661
Large ribosomal subunit protein uL15m (MRPL15) Universal ribosomal protein uL15 family Q9P015
Cold-inducible RNA-binding protein (CIRBP) . Q14011
Cytotoxic granule associated RNA binding protein TIA1 (TIA1) . P31483
DAZ-associated protein 1 (DAZAP1) . Q96EP5
GA-binding protein subunit beta-1 (GABPB1) . Q06547
Heterogeneous nuclear ribonucleoprotein K (HNRNPK) . P61978
KH domain-containing RNA-binding protein QKI (QKI) . Q96PU8
Leukocyte receptor cluster member 8 (LENG8) . Q96PV6
NADH dehydrogenase 1 alpha subcomplex assembly factor 3 (NDUFAF3) . Q9BU61
Poly(rC)-binding protein 1 (PCBP1) . Q15365
Poly(rC)-binding protein 2 (PCBP2) . Q15366
Polypyrimidine tract-binding protein 1 (PTBP1) . P26599
RAS protein activator like-3 (RASAL3) . Q86YV0
RNA-binding motif protein, X chromosome (RBMX) . P38159
RNA-binding motif protein, Y chromosome, family 1 member F/J (RBMY1F; RBMY1J) . Q15415
RNA-binding protein 3 (RBM3) . P98179
RNA-binding protein 4B (RBM4B) . Q9BQ04
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Splicing regulator RBM11 (RBM11) . P57052
Zinc finger CCHC domain-containing protein 13 (ZCCHC13) . Q8WW36

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Malonic Acid Small molecular drug DB02175

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
4 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
5 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
6 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
7 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
8 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
9 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
10 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
11 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
12 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.