Details of the Target

General Information of Target

Target ID LDTP02177
Target Name Acyl-CoA-binding protein (DBI)
Gene Name DBI
Gene ID 1622
Synonyms
Acyl-CoA-binding protein; ACBP; Diazepam-binding inhibitor; DBI; Endozepine; EP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
ELKGTSKEDAMKAYINKVEELKKKYGI
Target Bioclass
Other
Family
ACBP family
Subcellular location
Endoplasmic reticulum
Function
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Uniprot ID
P07108
Ensemble ID
ENST00000311521.8
HGNC ID
HGNC:2690

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 11 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		10.07  LDD0393  [1]
STPyne
 Probe Info  		K19(1.61); K55(8.36); K77(10.00)  LDD0277  [2]
ONAyne
 Probe Info  		N.A.  LDD0273  [2]
HHS-475
 Probe Info  		Y29(0.16)  LDD0264  [3]
W1
 Probe Info  		K55(4.49); W56(4.49)  LDD0237  [4]
AMP probe
 Probe Info  		N.A.  LDD0200  [5]
ATP probe
 Probe Info  		K55(0.00); K19(0.00); K63(0.00); K67(0.00)  LDD0199  [5]
ATP probe
 Probe Info  		K67(0.00); K82(0.00); K63(0.00)  LDD0035  [6]
NHS
 Probe Info  		N.A.  LDD0010  [7]
SF
 Probe Info  		Y32(0.00); K33(0.00)  LDD0028  [8]
1c-yne
 Probe Info  		N.A.  LDD0228  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y29(0.16)  LDD0264  [3]
 LDCM0117  HHS-0201 DM93 Y29(0.77)  LDD0265  [3]
 LDCM0118  HHS-0301 DM93 Y29(0.16)  LDD0266  [3]
 LDCM0119  HHS-0401 DM93 Y29(1.57)  LDD0267  [3]
 LDCM0120  HHS-0701 DM93 Y29(0.07)  LDD0268  [3]
 LDCM0110  W12 Hep-G2 K55(4.49); W56(4.49)  LDD0237  [4]
 LDCM0111  W14 Hep-G2 K55(3.86)  LDD0238  [4]
 LDCM0112  W16 Hep-G2 K55(0.72); W56(0.72)  LDD0239  [4]
 LDCM0113  W17 Hep-G2 K55(3.42); W56(3.42)  LDD0240  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Prefoldin subunit 2 (PFDN2) Prefoldin subunit beta family Q9UHV9

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Coenzyme A Small molecular drug DB01992
Hexadecanal Small molecular drug DB03381

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
4 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
5 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
6 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
7 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
8 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
9 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.