Details of the Target
General Information of Target
| Target ID | LDTP01938 | |||||
|---|---|---|---|---|---|---|
| Target Name | Apolipoprotein C-I (APOC1) | |||||
| Gene Name | APOC1 | |||||
| Gene ID | 341 | |||||
| Synonyms |
Apolipoprotein C-I; Apo-CI; ApoC-I; Apolipoprotein C1) [Cleaved into: Truncated apolipoprotein C-I] |
|||||
| 3D Structure | ||||||
| Sequence |
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
SAKMREWFSETFQKVKEKLKIDS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Apolipoprotein C1 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C017 Probe Info |
![]() |
5.78 | LDD1725 | [1] | |
|
C055 Probe Info |
![]() |
16.00 | LDD1752 | [1] | |
|
C056 Probe Info |
![]() |
34.06 | LDD1753 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Forkhead box protein D4-like 3 (FOXD4L3) | . | Q6VB84 | |||
Other



