Details of the Target

General Information of Target

Target ID LDTP00716
Target Name RNA binding protein fox-1 homolog 2 (RBFOX2)
Gene Name RBFOX2
Gene ID 23543
Synonyms
FOX2; HRNBP2; RBM9; RTA; RNA binding protein fox-1 homolog 2; Fox-1 homolog B; Hexaribonucleotide-binding protein 2; RNA-binding motif protein 9; RNA-binding protein 9; Repressor of tamoxifen transcriptional activity
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDY
AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKL
HGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLG
NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVP
PTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY
Target Bioclass
Other
Subcellular location
Nucleus
Function
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. Together with RNA binding proteins RBPMS and MBNL1/2, activates vascular smooth muscle cells alternative splicing events.
Uniprot ID
O43251
Ensemble ID
ENST00000262829.11
HGNC ID
HGNC:9906

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TH211
 Probe Info  		Y349(6.32)  LDD0257  [1]
Acrolein
 Probe Info  		N.A.  LDD0226  [2]
5E-2FA
 Probe Info  		N.A.  LDD2235  [3]
ATP probe
 Probe Info  		N.A.  LDD0199  [4]
m-APA
 Probe Info  		H181(0.00); H363(0.00)  LDD2231  [3]
PAL-AfBPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C252
 Probe Info  		10.27  LDD1925  [5]
C313
 Probe Info  		14.22  LDD1980  [5]
C314
 Probe Info  		11.55  LDD1981  [5]
FFF probe13
 Probe Info  		20.00  LDD0475  [6]
FFF probe2
 Probe Info  		20.00  LDD0463  [6]
FFF probe3
 Probe Info  		20.00  LDD0464  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa N.A.  LDD0226  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Proteasome subunit alpha type-3 (PSMA3) Peptidase T1A family P25788
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B) CAMK Ser/Thr protein kinase family Q13554
E3 ubiquitin-protein ligase RNF8 (RNF8) RNF8 family O76064
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Estrogen receptor (ESR1) Nuclear hormone receptor family P03372
Rhox homeobox family member 2 (RHOXF2) Paired-like homeobox family Q9BQY4
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Oxoeicosanoid receptor 1 (OXER1) G-protein coupled receptor 1 family Q8TDS5
Other
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Ataxin-1-like (ATXN1L) ATXN1 family P0C7T5
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
MAPK-interacting and spindle-stabilizing protein-like (MAPK1IP1L) MISS family Q8NDC0
H/ACA ribonucleoprotein complex non-core subunit NAF1 (NAF1) NAF1 family Q96HR8
Protein boule-like (BOLL) RRM DAZ family Q8N9W6
Protein VAC14 homolog (VAC14) VAC14 family Q08AM6
Calcium homeostasis endoplasmic reticulum protein (CHERP) . Q8IWX8
DAZ-associated protein 2 (DAZAP2) . Q15038
Disabled homolog 1 (DAB1) . O75553
Heterogeneous nuclear ribonucleoprotein F (HNRNPF) . P52597
Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) . P31943
KH domain-containing RNA-binding protein QKI (QKI) . Q96PU8
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Poly(rC)-binding protein 1 (PCBP1) . Q15365
Protein SPMIP9 (SPMIP9) . Q96LM6
RNA binding protein fox-1 homolog 1 (RBFOX1) . Q9NWB1
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Ubiquilin-2 (UBQLN2) . Q9UHD9
Uncharacterized protein C1orf94 (C1orf94) . Q6P1W5

References

1 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 Large-scale chemoproteomics expedites ligand discovery and predicts ligand behavior in cells. Science. 2024 Apr 26;384(6694):eadk5864. doi: 10.1126/science.adk5864. Epub 2024 Apr 26.
Mass spectrometry data entry: PXD041587
6 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.