Details of the Target
General Information of Target
| Target ID | LDTP19379 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B) | |||||
| Gene Name | TIMM23B | |||||
| Gene ID | 100652748 | |||||
| Synonyms |
Mitochondrial import inner membrane translocase subunit Tim23B; TIMM23B |
|||||
| 3D Structure | ||||||
| Sequence |
MPSQSACPVLSTAPGTPCDLRKHLLNMVSEEKRSPQLSAKTWRRGLRLQKRRNALFLPEG
DICVVGSTSGARALIPETSKLERSGTVIAYCNLELLASSDPPVWASQSTGMTGMSYRSQP QLGFKSTPPAHSSVFHHSVKAPKEDQAQEAASRPLTSQDGWNPNIKK |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Tim17/Tim22/Tim23 family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function | May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. the PAM complex. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
14.04 | LDD0402 | [1] | |
|
Jackson_1 Probe Info |
![]() |
20.00 | LDD0120 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C83(1.07); C84(1.07) | LDD2206 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
FFF probe11 Probe Info |
![]() |
20.00 | LDD0472 | [4] | |
|
FFF probe3 Probe Info |
![]() |
19.42 | LDD0465 | [4] | |
|
LD-F Probe Info |
![]() |
S139(0.00); D154(0.00); S133(0.00); Y138(0.00) | LDD0015 | [5] | |
Competitor(s) Related to This Target
References






