Details of the Target
General Information of Target
| Target ID | LDTP13985 | |||||
|---|---|---|---|---|---|---|
| Target Name | Small ribosomal subunit protein mS23 (MRPS23) | |||||
| Gene Name | MRPS23 | |||||
| Gene ID | 51649 | |||||
| Synonyms |
Small ribosomal subunit protein mS23; 28S ribosomal protein S23, mitochondrial; MRP-S23; S23mt |
|||||
| 3D Structure | ||||||
| Sequence |
MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDR
VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNI QCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Mitochondrion-specific ribosomal protein mS23 family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K73(6.88); K93(2.86) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y75(11.46); Y78(13.36) | LDD3495 | [2] | |
|
FBP2 Probe Info |
![]() |
3.54 | LDD0053 | [3] | |
|
Acrolein Probe Info |
![]() |
H142(0.00); H66(0.00) | LDD0221 | [4] | |
|
5E-2FA Probe Info |
![]() |
H66(0.00); H176(0.00); H153(0.00); H146(0.00) | LDD2235 | [5] | |
|
ATP probe Probe Info |
![]() |
K150(0.00); K93(0.00) | LDD0199 | [6] | |
|
m-APA Probe Info |
![]() |
H66(0.00); H176(0.00); H153(0.00); H146(0.00) | LDD2231 | [5] | |
|
Ox-W18 Probe Info |
![]() |
N.A. | LDD2175 | [7] | |
|
Crotonaldehyde Probe Info |
![]() |
H142(0.00); H146(0.00) | LDD0219 | [4] | |
|
TER-AC Probe Info |
![]() |
N.A. | LDD0426 | [8] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C278 Probe Info |
![]() |
99.73 | LDD1948 | [9] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) | Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family | O15160 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein goosecoid-2 (GSC2) | Paired homeobox family | O15499 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Harmonin-binding protein USHBP1 (USHBP1) | MCC family | Q8N6Y0 | |||
References











