Details of the Target
General Information of Target
| Target ID | LDTP13466 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase (MAN1B1) | |||||
| Gene Name | MAN1B1 | |||||
| Gene ID | 11253 | |||||
| Synonyms |
Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase; EC 3.2.1.113; ER alpha-1,2-mannosidase; ER mannosidase 1; ERMan1; Man9GlcNAc2-specific-processing alpha-mannosidase; Mannosidase alpha class 1B member 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVL
EDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQR RDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPG GQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyl hydrolase 47 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. It primarily trims a single alpha-1,2-linked mannose residue from Man(9)GlcNAc(2) to produce Man(8)GlcNAc(2), but at high enzyme concentrations, as found in the ER quality control compartment (ERQC), it further trims the carbohydrates to Man(5-6)GlcNAc(2).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
13.70 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K266(1.32) | LDD0277 | [2] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K354(2.82) | LDD3494 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C040 Probe Info |
![]() |
10.85 | LDD1740 | [5] | |
|
Alk-rapa Probe Info |
![]() |
6.98 | LDD0213 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References






