Details of the Target
General Information of Target
| Target ID | LDTP12978 | |||||
|---|---|---|---|---|---|---|
| Target Name | ORM1-like protein 1 (ORMDL1) | |||||
| Gene Name | ORMDL1 | |||||
| Gene ID | 94101 | |||||
| Synonyms |
ORM1-like protein 1; Adoplin-1 |
|||||
| 3D Structure | ||||||
| Sequence |
METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCA
DDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYRE AFGNALLQRLEALKRDGQS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ORM family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Plays an essential role in the homeostatic regulation of sphingolipid de novo biosynthesis by modulating the activity of the serine palmitoyltransferase (SPT) in response to ceramide levels. When complexed to SPT, the binding of ceramides to its N-terminus stabilizes a conformation that block SPT substrate entry, hence preventing SPT catalytic activity. Through this mechanism, maintains ceramide levels at sufficient concentrations for the production of complex sphingolipids, but which prevents the accumulation of ceramides to levels that trigger apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
![]() |
2.58 | LDD0066 | [1] | |
|
STPyne Probe Info |
![]() |
K152(6.39) | LDD0277 | [2] | |
|
FBP2 Probe Info |
![]() |
3.62 | LDD0320 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) | BZIP family | Q96BA8 | |||
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable G-protein coupled receptor 152 (GPR152) | G-protein coupled receptor 1 family | Q8TDT2 | |||
Other
References



