Details of the Target

General Information of Target

Target ID LDTP12978
Target Name ORM1-like protein 1 (ORMDL1)
Gene Name ORMDL1
Gene ID 94101
Synonyms
ORM1-like protein 1; Adoplin-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCA
DDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYRE
AFGNALLQRLEALKRDGQS
Target Bioclass
Other
Family
ORM family
Subcellular location
Endoplasmic reticulum membrane
Function
Plays an essential role in the homeostatic regulation of sphingolipid de novo biosynthesis by modulating the activity of the serine palmitoyltransferase (SPT) in response to ceramide levels. When complexed to SPT, the binding of ceramides to its N-terminus stabilizes a conformation that block SPT substrate entry, hence preventing SPT catalytic activity. Through this mechanism, maintains ceramide levels at sufficient concentrations for the production of complex sphingolipids, but which prevents the accumulation of ceramides to levels that trigger apoptosis.
Uniprot ID
Q9P0S3
Ensemble ID
ENST00000325795.7
HGNC ID
HGNC:16036

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		2.58  LDD0066  [1]
STPyne
 Probe Info  		K152(6.39)  LDD0277  [2]
FBP2
 Probe Info  		3.62  LDD0320  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0008  Tranylcypromine HeLa 3.62  LDD0320  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Palmitoyltransferase ZDHHC15 (ZDHHC15) DHHC palmitoyltransferase family Q96MV8
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
E3 ubiquitin-protein ligase RNF5 (RNF5) RNF5 family Q99942
Estradiol 17-beta-dehydrogenase 11 (HSD17B11) Short-chain dehydrogenases/reductases (SDR) family Q8NBQ5
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Stomatin (STOM) Band 7/mec-2 family P27105
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
Novel acetylcholine receptor chaperone (TMEM35A) DoxX family Q53FP2
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Protrudin (ZFYVE27) . Q5T4F4
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Ubiquinone biosynthesis protein COQ9, mitochondrial (COQ9) COQ9 family O75208
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Leptin receptor overlapping transcript-like 1 (LEPROTL1) OB-RGRP/VPS55 family O95214
Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) VMA21 family Q3ZAQ7
Receptor-binding cancer antigen expressed on SiSo cells (EBAG9) . O00559
Transmembrane protein 143 (TMEM143) . Q96AN5
Transmembrane protein 52B (TMEM52B) . Q4KMG9

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580