Details of the Target

General Information of Target

Target ID LDTP11418
Target Name EKC/KEOPS complex subunit GON7 (GON7)
Gene Name GON7
Gene ID 84520
Synonyms
EKC/KEOPS complex subunit GON7
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Target Bioclass
Other
Subcellular location
Nucleus
Function
Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 plays a supporting role to the catalytic subunit OSGEP in the complex.
Uniprot ID
Q9BXV9
Ensemble ID
ENST00000306954.5
HGNC ID
HGNC:20356

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBP2
 Probe Info  		3.57  LDD0323  [1]
IA-alkyne
 Probe Info  		C21(1.23)  LDD0304  [2]
DBIA
 Probe Info  		C21(2.98)  LDD3338  [3]
ATP probe
 Probe Info  		K13(0.00); K16(0.00)  LDD0199  [4]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [5]
JW-RF-010
 Probe Info  		N.A.  LDD0026  [6]
NAIA_5
 Probe Info  		N.A.  LDD2224  [7]
Acrolein
 Probe Info  		N.A.  LDD0217  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [8]
 LDCM0632  CL-Sc Hep-G2 C21(2.88)  LDD2227  [7]
 LDCM0369  CL100 HEK-293T C21(1.01)  LDD1573  [9]
 LDCM0373  CL104 HEK-293T C21(0.91)  LDD1577  [9]
 LDCM0377  CL108 HEK-293T C21(0.94)  LDD1581  [9]
 LDCM0382  CL112 HEK-293T C21(1.05)  LDD1586  [9]
 LDCM0386  CL116 HEK-293T C21(1.24)  LDD1590  [9]
 LDCM0391  CL120 HEK-293T C21(1.08)  LDD1595  [9]
 LDCM0395  CL124 HEK-293T C21(0.93)  LDD1599  [9]
 LDCM0399  CL128 HEK-293T C21(1.00)  LDD1603  [9]
 LDCM0403  CL16 HEK-293T C21(1.03)  LDD1607  [9]
 LDCM0416  CL28 HEK-293T C21(1.47)  LDD1620  [9]
 LDCM0429  CL4 HEK-293T C21(0.21)  LDD1633  [9]
 LDCM0430  CL40 HEK-293T C21(1.09)  LDD1634  [9]
 LDCM0443  CL52 HEK-293T C21(0.92)  LDD1646  [9]
 LDCM0456  CL64 HEK-293T C21(0.92)  LDD1659  [9]
 LDCM0469  CL76 HEK-293T C21(1.00)  LDD1672  [9]
 LDCM0482  CL88 HEK-293T C21(1.03)  LDD1685  [9]
 LDCM0572  Fragment10 Ramos C21(0.65)  LDD2189  [10]
 LDCM0573  Fragment11 Ramos C21(2.16)  LDD2190  [10]
 LDCM0574  Fragment12 Ramos C21(0.95)  LDD2191  [10]
 LDCM0575  Fragment13 Ramos C21(0.61)  LDD2192  [10]
 LDCM0576  Fragment14 Ramos C21(0.74)  LDD2193  [10]
 LDCM0579  Fragment20 Ramos C21(1.04)  LDD2194  [10]
 LDCM0580  Fragment21 Ramos C21(0.68)  LDD2195  [10]
 LDCM0582  Fragment23 Ramos C21(0.88)  LDD2196  [10]
 LDCM0578  Fragment27 Ramos C21(1.24)  LDD2197  [10]
 LDCM0588  Fragment30 Ramos C21(0.50)  LDD2199  [10]
 LDCM0589  Fragment31 Ramos C21(0.38)  LDD2200  [10]
 LDCM0590  Fragment32 Ramos C21(0.71)  LDD2201  [10]
 LDCM0468  Fragment33 Ramos C21(0.65)  LDD2202  [10]
 LDCM0596  Fragment38 Ramos C21(0.48)  LDD2203  [10]
 LDCM0566  Fragment4 Ramos C21(1.32)  LDD2184  [10]
 LDCM0610  Fragment52 Ramos C21(0.60)  LDD2204  [10]
 LDCM0614  Fragment56 Ramos C21(0.67)  LDD2205  [10]
 LDCM0569  Fragment7 Ramos C21(1.64)  LDD2186  [10]
 LDCM0571  Fragment9 Ramos C21(0.75)  LDD2188  [10]
 LDCM0107  IAA HeLa N.A.  LDD0221  [8]
 LDCM0022  KB02 Ramos C21(1.39)  LDD2182  [10]
 LDCM0023  KB03 Ramos C21(1.86)  LDD2183  [10]
 LDCM0024  KB05 MV4-11 C21(2.98)  LDD3338  [3]
 LDCM0131  RA190 MM1.R C21(1.23)  LDD0304  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
2 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
7 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
8 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
9 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
10 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578