Details of the Target
General Information of Target
| Target ID | LDTP10187 | |||||
|---|---|---|---|---|---|---|
| Target Name | Coiled-coil domain-containing protein 124 (CCDC124) | |||||
| Gene Name | CCDC124 | |||||
| Gene ID | 115098 | |||||
| Synonyms |
Coiled-coil domain-containing protein 124 |
|||||
| 3D Structure | ||||||
| Sequence |
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQ
ECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMT DETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLY GQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CCDC124 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
| Function |
Ribosome-binding protein involved in ribosome hibernation: associates with translationally inactive ribosomes and stabilizes the nonrotated conformation of the 80S ribosome, thereby promoting ribosome preservation and storage. Also required for proper progression of late cytokinetic stages.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
![]() |
12.08 | LDD0066 | [1] | |
|
AZ-9 Probe Info |
![]() |
E143(10.00) | LDD2209 | [2] | |
|
OPA-S-S-alkyne Probe Info |
![]() |
K94(4.68) | LDD3494 | [3] | |
|
AMP probe Probe Info |
![]() |
K121(0.00); K11(0.00) | LDD0200 | [4] | |
|
ATP probe Probe Info |
![]() |
K121(0.00); K11(0.00); K80(0.00); K82(0.00) | LDD0199 | [4] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [5] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [6] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [7] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [6] | |
|
Ox-W18 Probe Info |
![]() |
N.A. | LDD2175 | [8] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [9] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C003 Probe Info |
![]() |
13.27 | LDD1713 | [10] | |
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [11] | |
Competitor(s) Related to This Target
References













