Details of the Target

General Information of Target

Target ID LDTP09996
Target Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1)
Gene Name SMARCE1
Gene ID 6605
Synonyms
BAF57; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1; BRG1-associated factor 57; BAF57
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPGSWLDEMDHPPF
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Required for the coactivation of estrogen responsive promoters by SWI/SNF complexes and the SRC/p160 family of histone acetyltransferases (HATs). Also specifically interacts with the CoREST corepressor resulting in repression of neuronal specific gene promoters in non-neuronal cells.
Uniprot ID
Q969G3
Ensemble ID
ENST00000264640.9
HGNC ID
HGNC:11109

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
BT549 Insertion: p.Y76HfsTer10 .
HDMYZ Deletion: p.R216VfsTer7 .
Ishikawa (Heraklio) 02 ER SNV: p.R299K .
MCAS SNV: p.E114Q .
MV411 SNV: p.S172N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 17 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
AZ-9
 Probe Info  		10.00  LDD0393  [2]
C-Sul
 Probe Info  		5.75  LDD0066  [3]
FBP2
 Probe Info  		2.14  LDD0323  [4]
TH211
 Probe Info  		Y119(20.00); Y36(20.00)  LDD0257  [5]
Probe 1
 Probe Info  		Y115(13.26); Y119(15.23)  LDD3495  [6]
BTD
 Probe Info  		C274(0.67)  LDD2108  [7]
HHS-475
 Probe Info  		Y142(0.76); Y31(0.86); Y119(1.87)  LDD0264  [8]
Acrolein
 Probe Info  		N.A.  LDD0224  [9]
5E-2FA
 Probe Info  		N.A.  LDD2235  [10]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [11]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [11]
SF
 Probe Info  		N.A.  LDD0028  [12]
STPyne
 Probe Info  		N.A.  LDD0009  [13]
1c-yne
 Probe Info  		N.A.  LDD0228  [14]
HHS-465
 Probe Info  		K123(0.00); Y119(0.00)  LDD2240  [15]
HHS-482
 Probe Info  		Y119(0.99); Y36(1.33)  LDD2239  [16]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0548  1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one MDA-MB-231 C274(0.49)  LDD2142  [7]
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C274(0.60)  LDD2117  [7]
 LDCM0156  Aniline NCI-H1299 11.65  LDD0403  [1]
 LDCM0116  HHS-0101 DM93 Y142(0.76); Y31(0.86); Y119(1.87)  LDD0264  [8]
 LDCM0117  HHS-0201 DM93 Y142(0.34); Y119(3.21)  LDD0265  [8]
 LDCM0118  HHS-0301 DM93 Y142(0.81); Y119(2.88)  LDD0266  [8]
 LDCM0119  HHS-0401 DM93 Y142(0.75); Y119(1.89)  LDD0267  [8]
 LDCM0120  HHS-0701 DM93 Y142(1.18); Y31(2.34); Y119(3.56)  LDD0268  [8]
 LDCM0109  NEM HeLa N.A.  LDD0224  [9]
 LDCM0515  Nucleophilic fragment 20b MDA-MB-231 C274(0.67)  LDD2108  [7]
 LDCM0516  Nucleophilic fragment 21a MDA-MB-231 C274(0.53)  LDD2109  [7]
 LDCM0518  Nucleophilic fragment 22a MDA-MB-231 C274(0.96)  LDD2111  [7]
 LDCM0542  Nucleophilic fragment 37 MDA-MB-231 C274(1.09)  LDD2135  [7]
 LDCM0546  Nucleophilic fragment 40 MDA-MB-231 C274(0.52)  LDD2140  [7]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C274(0.55)  LDD2141  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 10B (PSMC6) AAA ATPase family P62333
Transcription activator BRG1 (SMARCA4) SNF2/RAD54 helicase family P51532
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
RalA-binding protein 1 (RALBP1) . Q15311
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Exocyst complex component 7 (EXOC7) EXO70 family Q9UPT5
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Intraflagellar transport protein 88 homolog (IFT88) . Q13099
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
REST corepressor 1 (RCOR1) CoREST family Q9UKL0
AT-rich interactive domain-containing protein 2 (ARID2) . Q68CP9
Homeobox protein MOX-2 (MEOX2) . P50222
Other
Click To Hide/Show 45 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Angiomotin-like protein 2 (AMOTL2) Angiomotin family Q9Y2J4
Breast cancer metastasis-suppressor 1 (BRMS1) BRMS1 family Q9HCU9
Coiled-coil domain-containing protein 172 (CCDC172) CCDC172 family P0C7W6
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Cep170-like protein (CEP170P1) CEP170 family Q96L14
Centrosomal protein of 63 kDa (CEP63) CEP63 family Q96MT8
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Epidermal growth factor receptor kinase substrate 8 (EPS8) EPS8 family Q12929
Protein FAM217B (FAM217B) FAM217 family Q9NTX9
Cdc42-interacting protein 4 (TRIP10) FNBP1 family Q15642
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Inhibitor of growth protein 5 (ING5) ING family Q8WYH8
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 39 (KRT39) Intermediate filament family Q6A163
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Janus kinase and microtubule-interacting protein 2 (JAKMIP2) JAKMIP family Q96AA8
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Mediator of RNA polymerase II transcription subunit 4 (MED4) Mediator complex subunit 4 family Q9NPJ6
Protein Mis18-beta (OIP5) Mis18 family O43482
MORF4 family-associated protein 1-like 1 (MRFAP1L1) MORF4 family-associated protein family Q96HT8
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
RAD50-interacting protein 1 (RINT1) RINT1 family Q6NUQ1
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
Syntaxin-11 (STX11) Syntaxin family O75558
Alpha-taxilin (TXLNA) Taxilin family P40222
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
GRIP1-associated protein 1 (GRIPAP1) . Q4V328
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
Sperm-associated antigen 5 (SPAG5) . Q96R06
Testis-expressed protein 12 (TEX12) . Q9BXU0

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Phenethyl Isothiocyanate Small molecular drug DB12695

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
4 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
5 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
6 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
7 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
8 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
9 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
10 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
11 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
12 Solid Phase Synthesis of Fluorosulfate Containing Macrocycles for Chemoproteomic Workflows. bioRxiv [Preprint]. 2023 Feb 18:2023.02.17.529022. doi: 10.1101/2023.02.17.529022.
Mass spectrometry data entry: PXD039931
13 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
14 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
15 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
16 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.