Details of the Target

General Information of Target

Target ID LDTP08213
Target Name Polyadenylate-binding protein 2 (PABPN1)
Gene Name PABPN1
Gene ID 8106
Synonyms
PAB2; PABP2; Polyadenylate-binding protein 2; PABP-2; Poly(A)-binding protein 2; Nuclear poly(A)-binding protein 1; Poly(A)-binding protein II; PABII; Polyadenylate-binding nuclear protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEEL
LLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
SWYSPY
Target Bioclass
Other
Subcellular location
Nucleus
Function
Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Is also present at various stages of mRNA metabolism including nucleocytoplasmic trafficking and nonsense-mediated decay (NMD) of mRNA. Cooperates with SKIP to synergistically activate E-box-mediated transcription through MYOD1 and may regulate the expression of muscle-specific genes. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation. Subunit of the trimeric poly(A) tail exosome targeting (PAXT) complex, a complex that directs a subset of long and polyadenylated poly(A) RNAs for exosomal degradation. The RNA exosome is fundamental for the degradation of RNA in eukaryotic nuclei. Substrate targeting is facilitated by its cofactor MTREX, which links to RNA-binding protein adapters.
Uniprot ID
Q86U42
Ensemble ID
ENST00000216727.9
HGNC ID
HGNC:8565

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
ICC10 Insertion: p.A83SfsTer26 DBIA    Probe Info 
ICC106 Insertion: p.A83SfsTer26 DBIA    Probe Info 
ICC108 Insertion: p.A83SfsTer26 DBIA    Probe Info 
KELLY SNV: p.A13P DBIA    Probe Info 
KMRC20 SNV: p.A3E DBIA    Probe Info 
KYM1 SNV: p.T256P DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 20 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
C-Sul
 Probe Info  		5.57  LDD0066  [1]
TH211
 Probe Info  		Y181(6.30)  LDD0257  [2]
IPM
 Probe Info  		N.A.  LDD0241  [3]
DBIA
 Probe Info  		C222(0.98); C232(1.02)  LDD3310  [4]
BTD
 Probe Info  		C205(0.20)  LDD2116  [5]
AHL-Pu-1
 Probe Info  		C205(2.16)  LDD0169  [6]
HHS-465
 Probe Info  		Y181(2.11)  LDD2237  [7]
m-APA
 Probe Info  		N.A.  LDD2231  [8]
4-Iodoacetamidophenylacetylene
 Probe Info  		C195(0.00); C205(0.00)  LDD0038  [9]
IA-alkyne
 Probe Info  		C195(0.00); C205(0.00)  LDD0036  [9]
IPIAA_H
 Probe Info  		N.A.  LDD0030  [10]
IPIAA_L
 Probe Info  		C205(0.00); C195(0.00)  LDD0031  [10]
Lodoacetamide azide
 Probe Info  		C195(0.00); C205(0.00)  LDD0037  [9]
TFBX
 Probe Info  		N.A.  LDD0027  [11]
Compound 10
 Probe Info  		N.A.  LDD2216  [12]
PF-06672131
 Probe Info  		N.A.  LDD0017  [13]
Acrolein
 Probe Info  		C195(0.00); C205(0.00)  LDD0217  [14]
Methacrolein
 Probe Info  		N.A.  LDD0218  [14]
W1
 Probe Info  		N.A.  LDD0236  [3]
HHS-482
 Probe Info  		Y273(0.60)  LDD2239  [7]
PAL-AfBPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FFF probe2
 Probe Info  		20.00  LDD0463  [15]
FFF probe3
 Probe Info  		11.13  LDD0464  [15]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0524  2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide MDA-MB-231 C205(0.87)  LDD2117  [5]
 LDCM0026  4SU-RNA+native RNA HEK-293T C205(2.16)  LDD0169  [6]
 LDCM0108  Chloroacetamide HeLa C195(0.00); C205(0.00)  LDD0222  [14]
 LDCM0625  F8 Ramos C205(1.96)  LDD2187  [16]
 LDCM0572  Fragment10 Ramos C205(0.75)  LDD2189  [16]
 LDCM0573  Fragment11 Ramos C205(0.16)  LDD2190  [16]
 LDCM0574  Fragment12 Ramos C205(0.70)  LDD2191  [16]
 LDCM0575  Fragment13 Ramos C205(1.32)  LDD2192  [16]
 LDCM0576  Fragment14 Ramos C205(0.84)  LDD2193  [16]
 LDCM0579  Fragment20 Ramos C205(0.56)  LDD2194  [16]
 LDCM0580  Fragment21 Ramos C205(0.87)  LDD2195  [16]
 LDCM0582  Fragment23 Ramos C205(1.01)  LDD2196  [16]
 LDCM0578  Fragment27 Ramos C205(1.88)  LDD2197  [16]
 LDCM0586  Fragment28 Ramos C205(0.77)  LDD2198  [16]
 LDCM0588  Fragment30 Ramos C205(1.46)  LDD2199  [16]
 LDCM0589  Fragment31 Ramos C205(1.29)  LDD2200  [16]
 LDCM0590  Fragment32 Ramos C205(0.88)  LDD2201  [16]
 LDCM0468  Fragment33 Ramos C205(1.31)  LDD2202  [16]
 LDCM0596  Fragment38 Ramos C205(1.37)  LDD2203  [16]
 LDCM0566  Fragment4 Ramos C205(0.74)  LDD2184  [16]
 LDCM0610  Fragment52 Ramos C205(0.82)  LDD2204  [16]
 LDCM0614  Fragment56 Ramos C205(1.20)  LDD2205  [16]
 LDCM0569  Fragment7 Ramos C205(0.77)  LDD2186  [16]
 LDCM0571  Fragment9 Ramos C205(0.53)  LDD2188  [16]
 LDCM0107  IAA HeLa C195(0.00); C205(0.00)  LDD0221  [14]
 LDCM0022  KB02 Ramos C205(0.78)  LDD2182  [16]
 LDCM0023  KB03 Ramos C205(0.74)  LDD2183  [16]
 LDCM0024  KB05 COLO792 C222(0.98); C232(1.02)  LDD3310  [4]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C205(0.20)  LDD2116  [5]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C205(0.87)  LDD2137  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Polyadenylate-binding protein 1 (PABPC1) Polyadenylate-binding protein type-1 family P11940
SNW domain-containing protein 1 (SNW1) SNW family Q13573

References

1 Low-Toxicity Sulfonium-Based Probes for Cysteine-Specific Profiling in Live Cells. Anal Chem. 2022 Mar 15;94(10):4366-4372. doi: 10.1021/acs.analchem.1c05129. Epub 2022 Mar 4.
2 Chemoproteomic profiling of kinases in live cells using electrophilic sulfonyl triazole probes. Chem Sci. 2021 Jan 21;12(9):3295-3307. doi: 10.1039/d0sc06623k.
3 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
4 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
5 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
6 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
7 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
8 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
9 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
10 SP3-Enabled Rapid and High Coverage Chemoproteomic Identification of Cell-State-Dependent Redox-Sensitive Cysteines. Mol Cell Proteomics. 2022 Apr;21(4):100218. doi: 10.1016/j.mcpro.2022.100218. Epub 2022 Feb 25.
Mass spectrometry data entry: PXD029500 , PXD031647
11 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
12 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
13 Site-Specific Activity-Based Protein Profiling Using Phosphonate Handles. Mol Cell Proteomics. 2023 Jan;22(1):100455. doi: 10.1016/j.mcpro.2022.100455. Epub 2022 Nov 24.
Mass spectrometry data entry: PXD036569
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 Ligand and Target Discovery by Fragment-Based Screening in Human Cells. Cell. 2017 Jan 26;168(3):527-541.e29. doi: 10.1016/j.cell.2016.12.029. Epub 2017 Jan 19.
16 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578