Details of the Target
General Information of Target
| Target ID | LDTP07973 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2A type 3 (H2AC25) | |||||
| Gene Name | H2AC25 | |||||
| Gene ID | 92815 | |||||
| Synonyms |
H2AW; HIST3H2A; Histone H2A type 3; H2A-clustered histone 25 |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2A family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y40(7.35) | LDD0260 | [1] | |
|
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
|
NHS Probe Info |
![]() |
K120(0.00); K96(0.00); K119(0.00) | LDD0010 | [3] | |
|
OSF Probe Info |
![]() |
N.A. | LDD0029 | [4] | |
|
SF Probe Info |
![]() |
K96(0.00); K126(0.00); K120(0.00); Y40(0.00) | LDD0028 | [4] | |
|
STPyne Probe Info |
![]() |
K96(0.00); K119(0.00); K120(0.00) | LDD0009 | [3] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BD-F Probe Info |
![]() |
T60(0.00); L56(0.00); A54(0.00); E62(0.00) | LDD0024 | [5] | |
|
LD-F Probe Info |
![]() |
L56(0.00); E62(0.00); A54(0.00); T60(0.00) | LDD0015 | [5] | |
|
TM-F Probe Info |
![]() |
E57(0.00); L56(0.00); T60(0.00) | LDD0020 | [5] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Heat shock factor 2-binding protein (HSF2BP) | . | O75031 | |||
References









