Details of the Target
General Information of Target
Target ID | LDTP07384 | |||||
---|---|---|---|---|---|---|
Target Name | Histone H2A type 2-A (H2AC18; H2AC19) | |||||
Gene Name | H2AC18; H2AC19 | |||||
Gene ID | 723790 | |||||
Synonyms |
H2AFO; HIST2H2AA; HIST2H2AA3; HIST2H2AA4; Histone H2A type 2-A; H2A-clustered histone 18; H2A-clustered histone 19; Histone H2A.2; Histone H2A/o |
|||||
3D Structure | ||||||
Sequence |
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK |
|||||
Target Bioclass |
Other
|
|||||
Family |
Histone H2A family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
ONAyne Probe Info |
![]() |
K96(2.53) | LDD0274 | [1] | |
STPyne Probe Info |
![]() |
K96(8.17) | LDD0277 | [1] | |
AZ-9 Probe Info |
![]() |
E92(1.09) | LDD2208 | [2] | |
NHS Probe Info |
![]() |
K119(0.00); K96(0.00); K120(0.00) | LDD0010 | [3] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-2 Probe Info |
![]() |
2.13 | LDD0138 | [4] | |
Photocelecoxib Probe Info |
![]() |
L56(0.00); Y58(0.00); E62(0.00); I63(0.00) | LDD0019 | [5] | |
Photoindomethacin Probe Info |
![]() |
A53(0.00); E62(0.00); A61(0.00) | LDD0155 | [5] | |
Photonaproxen Probe Info |
![]() |
E57(0.00); P49(0.00); I63(0.00) | LDD0157 | [5] | |
DA-2 Probe Info |
![]() |
N.A. | LDD0073 | [6] |
The Interaction Atlas With This Target
References