Details of the Target

General Information of Target

Target ID LDTP06482
Target Name Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)
Gene Name UBE2V2
Gene ID 7336
Synonyms
MMS2; UEV2; Ubiquitin-conjugating enzyme E2 variant 2; DDVit 1; Enterocyte differentiation-associated factor 1; EDAF-1; Enterocyte differentiation-promoting factor 1; EDPF-1; MMS2 homolog; Vitamin D3-inducible protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN
Target Bioclass
Enzyme
Family
Ubiquitin-conjugating enzyme family
Function
Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Uniprot ID
Q15819
Ensemble ID
ENST00000523111.7
HGNC ID
HGNC:12495

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 16 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
FBP2
 Probe Info  		2.72  LDD0323  [2]
AZ-9
 Probe Info  		E20(10.00); E17(10.00)  LDD2209  [3]
DA-P3
 Probe Info  		4.16  LDD0183  [4]
HHS-475
 Probe Info  		Y113(0.92)  LDD0264  [5]
HHS-465
 Probe Info  		Y113(10.00)  LDD2237  [6]
ATP probe
 Probe Info  		K72(0.00); K66(0.00)  LDD0199  [7]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [8]
ATP probe
 Probe Info  		N.A.  LDD0035  [9]
TFBX
 Probe Info  		N.A.  LDD0027  [10]
NHS
 Probe Info  		K8(0.00); K129(0.00)  LDD0010  [11]
1d-yne
 Probe Info  		N.A.  LDD0357  [12]
Acrolein
 Probe Info  		N.A.  LDD0217  [13]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [13]
Methacrolein
 Probe Info  		N.A.  LDD0218  [13]
NAIA_5
 Probe Info  		N.A.  LDD2223  [14]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [13]
 LDCM0632  CL-Sc Hep-G2 C69(20.00)  LDD2227  [14]
 LDCM0031  Epigallocatechin gallate HEK-293T 4.16  LDD0183  [4]
 LDCM0572  Fragment10 Ramos C69(0.47)  LDD2189  [15]
 LDCM0573  Fragment11 Ramos C69(1.48)  LDD2190  [15]
 LDCM0574  Fragment12 Ramos C69(0.21)  LDD2191  [15]
 LDCM0575  Fragment13 Ramos C69(0.58)  LDD2192  [15]
 LDCM0576  Fragment14 Ramos C69(0.51)  LDD2193  [15]
 LDCM0579  Fragment20 Ramos C69(0.19)  LDD2194  [15]
 LDCM0580  Fragment21 Ramos C69(0.72)  LDD2195  [15]
 LDCM0582  Fragment23 Ramos C69(3.37)  LDD2196  [15]
 LDCM0578  Fragment27 Ramos C69(0.73)  LDD2197  [15]
 LDCM0588  Fragment30 Ramos C69(0.54)  LDD2199  [15]
 LDCM0589  Fragment31 Ramos C69(0.72)  LDD2200  [15]
 LDCM0590  Fragment32 Ramos C69(0.34)  LDD2201  [15]
 LDCM0468  Fragment33 Ramos C69(0.62)  LDD2202  [15]
 LDCM0596  Fragment38 Ramos C69(0.71)  LDD2203  [15]
 LDCM0610  Fragment52 Ramos C69(0.85)  LDD2204  [15]
 LDCM0571  Fragment9 Ramos C69(0.34)  LDD2188  [15]
 LDCM0116  HHS-0101 DM93 Y113(0.92)  LDD0264  [5]
 LDCM0117  HHS-0201 DM93 Y113(0.85)  LDD0265  [5]
 LDCM0118  HHS-0301 DM93 Y113(0.89)  LDD0266  [5]
 LDCM0119  HHS-0401 DM93 Y113(0.96)  LDD0267  [5]
 LDCM0120  HHS-0701 DM93 Y113(0.95)  LDD0268  [5]
 LDCM0107  IAA HeLa N.A.  LDD0221  [13]
 LDCM0109  NEM HeLa N.A.  LDD0223  [13]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin-conjugating enzyme E2 N (UBE2N) Ubiquitin-conjugating enzyme family P61088

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
3 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
4 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
5 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
6 Global targeting of functional tyrosines using sulfur-triazole exchange chemistry. Nat Chem Biol. 2020 Feb;16(2):150-159. doi: 10.1038/s41589-019-0404-5. Epub 2019 Nov 25.
7 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
8 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
9 Comparison of Quantitative Mass Spectrometry Platforms for Monitoring Kinase ATP Probe Uptake in Lung Cancer. J Proteome Res. 2018 Jan 5;17(1):63-75. doi: 10.1021/acs.jproteome.7b00329. Epub 2017 Nov 22.
Mass spectrometry data entry: PXD006095 , PXD006096
10 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
11 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
12 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
13 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
14 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
15 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578