Details of the Target

General Information of Target

Target ID LDTP06354
Target Name Interferon regulatory factor 4 (IRF4)
Gene Name IRF4
Gene ID 3662
Synonyms
MUM1; Interferon regulatory factor 4; IRF-4; Lymphocyte-specific interferon regulatory factor; LSIRF; Multiple myeloma oncogene 1; NF-EM5
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Target Bioclass
Transcription factor
Family
IRF family
Subcellular location
Nucleus
Function
Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 and activation of genes.
Uniprot ID
Q15306
Ensemble ID
ENST00000380956.9
HGNC ID
HGNC:6119

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A549 Deletion: p.R51AfsTer51 .
HGC27 SNV: p.E130K .
JURKAT SNV: p.P129H .
L428 SNV: p.C99R; p.S104T .
LNCaP clone FGC SNV: p.K306N .
NCIH146 Substitution: p.H278N .
OCILY3 SNV: p.A100T DBIA    Probe Info 
P31FUJ SNV: p.L378M .
TOV21G SNV: p.I118N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K327(3.94)  LDD2218  [1]
IA-alkyne
 Probe Info  		C194(7.46); C19(1.99); C250(1.18); C343(1.05)  LDD0304  [2]
DBIA
 Probe Info  		C274(1.66); C343(1.31)  LDD3332  [3]
Alkyne-RA190
 Probe Info  		2.80  LDD0299  [2]
HHS-475
 Probe Info  		Y428(0.05); Y415(1.71)  LDD0264  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C250(1.21); C19(1.34); C194(1.15); C343(1.48)  LDD2187  [5]
 LDCM0572  Fragment10 Ramos C250(0.34); C19(0.99); C194(3.67); C343(0.40)  LDD2189  [5]
 LDCM0573  Fragment11 Ramos C250(0.25); C19(0.38); C194(0.44); C343(0.34)  LDD2190  [5]
 LDCM0574  Fragment12 Ramos C250(0.63); C19(1.50); C194(2.68); C343(0.30)  LDD2191  [5]
 LDCM0575  Fragment13 Ramos C250(0.84); C19(1.20); C194(1.12); C343(0.57)  LDD2192  [5]
 LDCM0576  Fragment14 Ramos C250(0.73); C19(0.81); C194(0.98); C343(0.68)  LDD2193  [5]
 LDCM0579  Fragment20 Ramos C250(0.73); C19(1.10); C194(3.51); C343(0.30)  LDD2194  [5]
 LDCM0580  Fragment21 Ramos C250(0.80); C19(0.95); C194(1.03); C343(0.36)  LDD2195  [5]
 LDCM0582  Fragment23 Ramos C250(0.44); C19(1.31); C194(0.89); C343(0.68)  LDD2196  [5]
 LDCM0578  Fragment27 Ramos C250(0.95); C19(0.82); C194(0.92); C343(1.07)  LDD2197  [5]
 LDCM0586  Fragment28 Ramos C250(1.42); C19(0.62); C194(0.67); C343(0.53)  LDD2198  [5]
 LDCM0588  Fragment30 Ramos C250(0.75); C19(1.41); C194(1.31); C343(0.52)  LDD2199  [5]
 LDCM0589  Fragment31 Ramos C250(0.85); C19(1.10); C194(1.03); C343(0.64)  LDD2200  [5]
 LDCM0590  Fragment32 Ramos C250(0.52); C19(1.21); C194(3.19); C343(0.34)  LDD2201  [5]
 LDCM0468  Fragment33 Ramos C250(0.68); C19(1.28); C194(1.39); C343(0.41)  LDD2202  [5]
 LDCM0596  Fragment38 Ramos C250(0.76); C19(1.39); C194(0.92); C343(0.63)  LDD2203  [5]
 LDCM0566  Fragment4 Ramos C250(0.90); C19(0.77); C194(2.30); C343(0.72)  LDD2184  [5]
 LDCM0610  Fragment52 Ramos C250(0.70); C19(1.33); C194(1.14); C343(0.75)  LDD2204  [5]
 LDCM0614  Fragment56 Ramos C250(0.88); C19(1.26); C194(0.94); C343(0.50)  LDD2205  [5]
 LDCM0569  Fragment7 Ramos C250(0.66); C19(0.77); C194(1.96); C343(0.64)  LDD2186  [5]
 LDCM0571  Fragment9 Ramos C250(0.38); C19(1.50); C194(3.20); C343(0.32)  LDD2188  [5]
 LDCM0116  HHS-0101 DM93 Y428(0.05); Y415(1.71)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y415(1.23)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y415(1.46)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y415(0.73)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y428(0.05); Y415(1.80)  LDD0268  [4]
 LDCM0022  KB02 Ramos 6.24  LDD0431  [6]
 LDCM0023  KB03 Ramos C250(0.77); C19(0.86); C194(1.43); C343(0.67)  LDD2183  [5]
 LDCM0024  KB05 MKN45 C274(1.66); C343(1.31)  LDD3332  [3]
 LDCM0131  RA190 MM1.R 2.80  LDD0299  [2]
 LDCM0170  Structure8 Ramos 7.13; 4.52  LDD0433  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3'-5' RNA helicase YTHDC2 (YTHDC2) DEAD box helicase family Q9H6S0
Serine/threonine-protein kinase tousled-like 2 (TLK2) Ser/Thr protein kinase family Q86UE8
Interleukin-1 receptor-associated kinase 1 (IRAK1) TKL Ser/Thr protein kinase family P51617
tRNA-splicing endonuclease subunit Sen54 (TSEN54) SEN54 family Q7Z6J9
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Elongator complex protein 1 (ELP1) ELP1/IKA1 family O95163
PDZ domain-containing protein GIPC2 (GIPC2) GIPC family Q8TF65

References

1 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
2 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
6 2-Sulfonylpyridines as Tunable, Cysteine-Reactive Electrophiles. J Am Chem Soc. 2020 May 13;142(19):8972-8979. doi: 10.1021/jacs.0c02721. Epub 2020 Apr 29.