Details of the Target
General Information of Target
| Target ID | LDTP06304 | |||||
|---|---|---|---|---|---|---|
| Target Name | Bromodomain-containing protein 3 (BRD3) | |||||
| Gene Name | BRD3 | |||||
| Gene ID | 8019 | |||||
| Synonyms |
KIAA0043; RING3L; Bromodomain-containing protein 3; RING3-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS DSSDSE |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Chromatin reader that recognizes and binds acetylated histones, thereby controlling gene expression and remodeling chromatin structures. Recruits transcription factors and coactivators to target gene sites, and activates RNA polymerase II machinery for transcriptional elongation. In vitro, binds acetylated lysine residues on the N-terminus of histone H2A, H2B, H3 and H4. Involved in endoderm differentiation via its association with long non-coding RNA (lncRNA) DIGIT: BRD3 undergoes liquid-liquid phase separation upon binding to lncRNA DIGIT, promoting binding to histone H3 acetylated at 'Lys-18' (H3K18ac) to induce endoderm gene expression. Also binds non-histones acetylated proteins, such as GATA1 and GATA2: regulates transcription by promoting the binding of the transcription factor GATA1 to its targets.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| EFO27 | SNV: p.G717R | DBIA Probe Info | |||
| HCT15 | SNV: p.P299S | DBIA Probe Info | |||
| HEP3B217 | SNV: p.S434N | DBIA Probe Info | |||
| HT115 | SNV: p.N37K | DBIA Probe Info | |||
| JHH4 | SNV: p.H327L | DBIA Probe Info | |||
| KARPAS422 | SNV: p.K497R; p.K534R | DBIA Probe Info | |||
| KELLY | SNV: p.P355Q | . | |||
| KYSE30 | SNV: p.E409K | . | |||
| MEWO | Substitution: p.P355L | DBIA Probe Info | |||
| NCIH1048 | SNV: p.K591R | DBIA Probe Info | |||
| RL952 | SNV: p.R284H | DBIA Probe Info | |||
| SKMEL5 | SNV: p.Q662Ter | DBIA Probe Info | |||
| SW1783 | SNV: p.R578H | DBIA Probe Info | |||
| TE4 | SNV: p.T544N | DBIA Probe Info | |||
| TYKNU | SNV: p.S715F | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y370(6.63) | LDD3495 | [1] | |
|
DBIA Probe Info |
![]() |
C429(2.51) | LDD3310 | [2] | |
|
BTD Probe Info |
![]() |
C387(2.10) | LDD2135 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0223 | [4] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [5] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0032 | [6] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [5] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [7] | |
|
8df Probe Info |
![]() |
5.70 | LDD0250 | [8] | |
|
8ef Probe Info |
![]() |
6.73 | LDD0251 | [8] | |
|
photo_BS Probe Info |
![]() |
2.35 | LDD0412 | [9] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0092 | Amine 8 | HL-60 | 5.70 | LDD0250 | [8] |
| LDCM0160 | Bromosprine | HEK-293T | 2.35 | LDD0412 | [9] |
| LDCM0022 | KB02 | 42-MG-BA | C429(2.18) | LDD2244 | [2] |
| LDCM0023 | KB03 | 42-MG-BA | C429(2.78) | LDD2661 | [2] |
| LDCM0024 | KB05 | COLO792 | C429(2.51) | LDD3310 | [2] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [4] |
| LDCM0542 | Nucleophilic fragment 37 | MDA-MB-231 | C387(2.10) | LDD2135 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Importin subunit alpha-4 (KPNA3) | Importin alpha family | O00505 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Myc proto-oncogene protein (MYC) | . | P01106 | |||
The Drug(s) Related To This Target
Phase 1
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Abbv-744 | . | D05ICT | |||
Investigative
Patented
References











