Details of the Target

General Information of Target

Target ID LDTP05462
Target Name Caldesmon (CALD1)
Gene Name CALD1
Gene ID 800
Synonyms
CAD; CDM; Caldesmon; CDM
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLG
QVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKE
FDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDA
EENKKEDKEKEEEEEEKPKRGSIGENQVEVMVEEKTTESQEETVVMSLKNGQISSEEPKQ
EEEREQGSDEISHHEKMEEEDKERAEAERARLEAEERERIKAEQDKKIADERARIEAEEK
AAAQERERREAEERERMREEEKRAAEERQRIKEEEKRAAEERQRIKEEEKRAAEERQRIK
EEEKRAAEERQRARAEEEEKAKVEEQKRNKQLEEKKHAMQETKIKGEKVEQKIEGKWVNE
KKAQEDKLQTAVLKKQGEEKGTKVQAKREKLQEDKPTFKKEEIKDEKIKKDKEPKEEVKS
FMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELR
RRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEE
KRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKS
SGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGN
VFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWE
KQSVDKVTSPTKV
Target Bioclass
Other
Family
Caldesmon family
Subcellular location
Cytoplasm, cytoskeleton
Function
Actin- and myosin-binding protein implicated in the regulation of actomyosin interactions in smooth muscle and nonmuscle cells (could act as a bridge between myosin and actin filaments). Stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, inhibits the actomyosin ATPase by binding to F-actin. This inhibition is attenuated by calcium-calmodulin and is potentiated by tropomyosin. Interacts with actin, myosin, two molecules of tropomyosin and with calmodulin. Also plays an essential role during cellular mitosis and receptor capping. Involved in Schwann cell migration during peripheral nerve regeneration.
Uniprot ID
Q05682
Ensemble ID
ENST00000361675.7
HGNC ID
HGNC:1441

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL62 SNV: p.D483V .
FADU SNV: p.G441V .
G415 SNV: p.T442N .
HT115 SNV: p.R7C; p.R593Q .
Ishikawa (Heraklio) 02 ER Insertion: p.K422EfsTer6 .
LNCaP clone FGC SNV: p.E283D .
NCIH1666 SNV: p.P633S .
ZR751 SNV: p.E186Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 19 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
AZ-9
 Probe Info  		5.10  LDD0393  [2]
ONAyne
 Probe Info  		K618(5.88); K781(7.14)  LDD0274  [3]
STPyne
 Probe Info  		K486(2.70); K502(9.60); K504(7.45); K534(4.48)  LDD0277  [3]
OPA-S-S-alkyne
 Probe Info  		K534(0.79); K577(1.10); K674(2.25); K119(2.67)  LDD3494  [4]
DA-P3
 Probe Info  		4.32  LDD0182  [5]
HHS-475
 Probe Info  		Y682(0.88); Y160(0.89)  LDD0264  [6]
5E-2FA
 Probe Info  		N.A.  LDD2235  [7]
ATP probe
 Probe Info  		K631(0.00); K632(0.00); K635(0.00)  LDD0199  [8]
BTD
 Probe Info  		N.A.  LDD0004  [9]
IPM
 Probe Info  		N.A.  LDD0025  [10]
YN-1
 Probe Info  		D187(0.00); E189(0.00)  LDD0447  [11]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [12]
1d-yne
 Probe Info  		N.A.  LDD0357  [13]
Acrolein
 Probe Info  		N.A.  LDD0217  [14]
Crotonaldehyde
 Probe Info  		N.A.  LDD0219  [14]
Methacrolein
 Probe Info  		N.A.  LDD0218  [14]
AOyne
 Probe Info  		9.20  LDD0443  [15]
HHS-465
 Probe Info  		Y160(0.00); Y682(0.00)  LDD2240  [16]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 11.65  LDD0403  [1]
 LDCM0498  BS-3668 MDA-MB-231 C636(0.51)  LDD2091  [17]
 LDCM0108  Chloroacetamide HeLa H667(0.00); H505(0.00)  LDD0222  [14]
 LDCM0116  HHS-0101 DM93 Y682(0.88); Y160(0.89)  LDD0264  [6]
 LDCM0117  HHS-0201 DM93 Y682(0.73); Y160(0.83)  LDD0265  [6]
 LDCM0118  HHS-0301 DM93 Y682(0.91); Y160(0.92)  LDD0266  [6]
 LDCM0119  HHS-0401 DM93 Y160(0.84); Y682(1.11)  LDD0267  [6]
 LDCM0120  HHS-0701 DM93 Y160(0.86); Y682(1.16)  LDD0268  [6]
 LDCM0107  IAA HeLa N.A.  LDD0221  [14]
 LDCM0030  Luteolin HEK-293T 4.32  LDD0182  [5]
 LDCM0109  NEM HeLa N.A.  LDD0223  [14]
 LDCM0499  Nucleophilic fragment 12b MDA-MB-231 C636(1.01)  LDD2092  [17]
 LDCM0501  Nucleophilic fragment 13b MDA-MB-231 C636(1.90)  LDD2094  [17]
 LDCM0503  Nucleophilic fragment 14b MDA-MB-231 C636(0.51)  LDD2096  [17]
 LDCM0505  Nucleophilic fragment 15b MDA-MB-231 C636(1.31)  LDD2098  [17]
 LDCM0512  Nucleophilic fragment 19a MDA-MB-231 C636(2.51)  LDD2105  [17]
 LDCM0523  Nucleophilic fragment 24b MDA-MB-231 C636(0.65)  LDD2116  [17]
 LDCM0525  Nucleophilic fragment 25b MDA-MB-231 C636(0.78)  LDD2118  [17]
 LDCM0529  Nucleophilic fragment 27b MDA-MB-231 C636(0.78)  LDD2122  [17]
 LDCM0531  Nucleophilic fragment 28b MDA-MB-231 C636(0.51)  LDD2124  [17]
 LDCM0533  Nucleophilic fragment 29b MDA-MB-231 C636(0.59)  LDD2126  [17]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C636(0.97)  LDD2128  [17]
 LDCM0555  Nucleophilic fragment 7b MDA-MB-231 C636(0.59)  LDD2149  [17]
 LDCM0556  Nucleophilic fragment 8a MDA-MB-231 C636(0.49)  LDD2150  [17]
 LDCM0557  Nucleophilic fragment 8b MDA-MB-231 C636(1.10)  LDD2151  [17]
 LDCM0559  Nucleophilic fragment 9b MDA-MB-231 C636(3.26)  LDD2153  [17]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
TERF1-interacting nuclear factor 2 (TINF2) . Q9BSI4

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
4 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
5 A chemical probe unravels the reactive proteome of health-associated catechols. Chem Sci. 2023 Jul 22;14(32):8635-8643. doi: 10.1039/d3sc00888f. eCollection 2023 Aug 16.
Mass spectrometry data entry: PXD043348
6 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
9 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
10 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
11 Ynamide Electrophile for the Profiling of Ligandable Carboxyl Residues in Live Cells and the Development of New Covalent Inhibitors. J Med Chem. 2022 Aug 11;65(15):10408-10418. doi: 10.1021/acs.jmedchem.2c00272. Epub 2022 Jul 26.
12 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
13 Tunable Amine-Reactive Electrophiles for Selective Profiling of Lysine. Angew Chem Int Ed Engl. 2022 Jan 26;61(5):e202112107. doi: 10.1002/anie.202112107. Epub 2021 Dec 16.
14 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
15 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
16 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
17 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761