Details of the Target

General Information of Target

Target ID LDTP05381
Target Name Cyclic AMP-responsive element-binding protein 5 (CREB5)
Gene Name CREB5
Gene ID 9586
Synonyms
CREBPA; Cyclic AMP-responsive element-binding protein 5; CREB-5; cAMP-responsive element-binding protein 5; cAMP-response element-binding protein A; CRE-BPa
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
Target Bioclass
Transcription factor
Family
BZIP family
Subcellular location
Nucleus
Function Binds to the cAMP response element and activates transcription.
Uniprot ID
Q02930
Ensemble ID
ENST00000357727.7
HGNC ID
HGNC:16844

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO792 SNV: p.P506S .
CORL23 SNV: p.M1? .
DU145 SNV: p.G256Ter .
HCT15 SNV: p.H279Y .
HSC4 SNV: p.P15R .
HT115 SNV: p.K233N .
IGR1 SNV: p.N124S .
MCC26 SNV: p.P158S DBIA    Probe Info 
MFE296 SNV: p.Q418R DBIA    Probe Info 
NCIH1792 SNV: p.T150N .
NCIH2286 SNV: p.S484Ter .
PF382 SNV: p.R391C .
SW948 SNV: p.T63M; p.R386W .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AHL-Pu-1
 Probe Info  		C80(3.48); C220(4.11)  LDD0170  [1]
DBIA
 Probe Info  		C69(2.66); C80(2.66)  LDD0080  [2]
IPM
 Probe Info  		N.A.  LDD2156  [3]
Phosphinate-6
 Probe Info  		C80(0.00); C392(0.00)  LDD0018  [4]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		N.A.  LDD0139  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C80(3.48); C220(4.11)  LDD0170  [1]
 LDCM0026  4SU-RNA+native RNA DM93 C69(4.07); C220(2.15)  LDD0171  [1]
 LDCM0226  AC11 HEK-293T C220(1.20); C69(0.95); C80(1.01)  LDD1509  [6]
 LDCM0237  AC12 HEK-293T C80(1.33)  LDD1510  [6]
 LDCM0259  AC14 HEK-293T C80(0.98)  LDD1512  [6]
 LDCM0270  AC15 HEK-293T C220(0.96)  LDD1513  [6]
 LDCM0278  AC19 HEK-293T C220(1.52); C69(0.95); C80(1.05)  LDD1517  [6]
 LDCM0280  AC20 HEK-293T C80(0.79)  LDD1519  [6]
 LDCM0282  AC22 HEK-293T C80(1.13)  LDD1521  [6]
 LDCM0283  AC23 HEK-293T C220(0.99)  LDD1522  [6]
 LDCM0287  AC27 HEK-293T C220(1.22); C69(1.21); C80(1.02)  LDD1526  [6]
 LDCM0288  AC28 HEK-293T C80(1.26)  LDD1527  [6]
 LDCM0290  AC3 HEK-293T C220(1.32); C69(1.30); C80(1.57)  LDD1529  [6]
 LDCM0291  AC30 HEK-293T C80(1.73)  LDD1530  [6]
 LDCM0292  AC31 HEK-293T C220(0.88)  LDD1531  [6]
 LDCM0296  AC35 HEK-293T C220(1.19); C69(1.00); C80(0.97)  LDD1535  [6]
 LDCM0297  AC36 HEK-293T C80(0.76)  LDD1536  [6]
 LDCM0299  AC38 HEK-293T C80(1.63)  LDD1538  [6]
 LDCM0300  AC39 HEK-293T C220(1.29)  LDD1539  [6]
 LDCM0301  AC4 HEK-293T C80(1.13)  LDD1540  [6]
 LDCM0305  AC43 HEK-293T C220(1.13); C69(0.84); C80(1.29)  LDD1544  [6]
 LDCM0306  AC44 HEK-293T C80(1.10)  LDD1545  [6]
 LDCM0308  AC46 HEK-293T C80(1.32)  LDD1547  [6]
 LDCM0309  AC47 HEK-293T C220(1.03)  LDD1548  [6]
 LDCM0314  AC51 HEK-293T C220(0.99); C69(1.00); C80(1.35)  LDD1553  [6]
 LDCM0315  AC52 HEK-293T C80(0.82)  LDD1554  [6]
 LDCM0317  AC54 HEK-293T C80(0.94)  LDD1556  [6]
 LDCM0318  AC55 HEK-293T C220(0.96)  LDD1557  [6]
 LDCM0322  AC59 HEK-293T C220(1.15); C69(0.82); C80(1.24)  LDD1561  [6]
 LDCM0323  AC6 HEK-293T C80(2.07)  LDD1562  [6]
 LDCM0324  AC60 HEK-293T C80(1.02)  LDD1563  [6]
 LDCM0326  AC62 HEK-293T C80(1.19)  LDD1565  [6]
 LDCM0327  AC63 HEK-293T C220(0.94)  LDD1566  [6]
 LDCM0334  AC7 HEK-293T C220(1.00)  LDD1568  [6]
 LDCM0368  CL10 HEK-293T C80(0.45)  LDD1572  [6]
 LDCM0372  CL103 HEK-293T C80(0.93)  LDD1576  [6]
 LDCM0376  CL107 HEK-293T C80(0.98)  LDD1580  [6]
 LDCM0379  CL11 HEK-293T C220(0.90)  LDD1583  [6]
 LDCM0381  CL111 HEK-293T C80(1.20)  LDD1585  [6]
 LDCM0385  CL115 HEK-293T C80(1.12)  LDD1589  [6]
 LDCM0389  CL119 HEK-293T C80(1.03)  LDD1593  [6]
 LDCM0394  CL123 HEK-293T C80(1.18)  LDD1598  [6]
 LDCM0398  CL127 HEK-293T C80(1.48)  LDD1602  [6]
 LDCM0402  CL15 HEK-293T C80(0.76)  LDD1606  [6]
 LDCM0406  CL19 HEK-293T C220(0.95); C69(1.25); C80(0.50)  LDD1610  [6]
 LDCM0408  CL20 HEK-293T C80(0.31)  LDD1612  [6]
 LDCM0410  CL22 HEK-293T C80(0.39)  LDD1614  [6]
 LDCM0411  CL23 HEK-293T C220(0.75)  LDD1615  [6]
 LDCM0415  CL27 HEK-293T C80(0.76)  LDD1619  [6]
 LDCM0418  CL3 HEK-293T C80(0.93)  LDD1622  [6]
 LDCM0420  CL31 HEK-293T C220(0.83); C69(1.01); C80(0.48)  LDD1624  [6]
 LDCM0421  CL32 HEK-293T C80(0.41)  LDD1625  [6]
 LDCM0423  CL34 HEK-293T C80(0.47)  LDD1627  [6]
 LDCM0424  CL35 HEK-293T C220(0.70)  LDD1628  [6]
 LDCM0428  CL39 HEK-293T C80(1.05)  LDD1632  [6]
 LDCM0433  CL43 HEK-293T C220(1.18); C69(1.02); C80(0.53)  LDD1637  [6]
 LDCM0434  CL44 HEK-293T C80(0.40)  LDD1638  [6]
 LDCM0436  CL46 HEK-293T C80(0.46)  LDD1640  [6]
 LDCM0437  CL47 HEK-293T C220(0.69)  LDD1641  [6]
 LDCM0446  CL55 HEK-293T C220(0.88); C69(0.95); C80(0.85)  LDD1649  [6]
 LDCM0447  CL56 HEK-293T C80(0.54)  LDD1650  [6]
 LDCM0449  CL58 HEK-293T C80(0.47)  LDD1652  [6]
 LDCM0450  CL59 HEK-293T C220(0.78)  LDD1653  [6]
 LDCM0455  CL63 HEK-293T C80(1.06)  LDD1658  [6]
 LDCM0459  CL67 HEK-293T C220(0.96); C69(0.94); C80(0.68)  LDD1662  [6]
 LDCM0460  CL68 HEK-293T C80(0.48)  LDD1663  [6]
 LDCM0462  CL7 HEK-293T C220(1.02); C69(0.95); C80(0.61)  LDD1665  [6]
 LDCM0463  CL70 HEK-293T C80(0.54)  LDD1666  [6]
 LDCM0464  CL71 HEK-293T C220(0.59)  LDD1667  [6]
 LDCM0472  CL79 HEK-293T C220(0.84); C69(0.82); C80(0.57)  LDD1675  [6]
 LDCM0473  CL8 HEK-293T C80(0.43)  LDD1676  [6]
 LDCM0474  CL80 HEK-293T C80(0.44)  LDD1677  [6]
 LDCM0476  CL82 HEK-293T C80(0.79)  LDD1679  [6]
 LDCM0477  CL83 HEK-293T C220(0.69)  LDD1680  [6]
 LDCM0481  CL87 HEK-293T C80(2.14)  LDD1684  [6]
 LDCM0486  CL91 HEK-293T C220(1.15); C69(1.14); C80(0.76)  LDD1689  [6]
 LDCM0487  CL92 HEK-293T C80(0.63)  LDD1690  [6]
 LDCM0489  CL94 HEK-293T C80(0.97)  LDD1692  [6]
 LDCM0490  CL95 HEK-293T C220(0.79)  LDD1693  [6]
 LDCM0494  CL99 HEK-293T C80(1.78)  LDD1697  [6]
 LDCM0495  E2913 HEK-293T C80(0.88)  LDD1698  [6]
 LDCM0468  Fragment33 HEK-293T C80(1.04)  LDD1671  [6]
 LDCM0022  KB02 HCT 116 C69(2.66); C80(2.66)  LDD0080  [2]
 LDCM0023  KB03 HCT 116 C69(2.07); C80(2.07)  LDD0081  [2]
 LDCM0024  KB05 HCT 116 C69(2.04); C80(2.04)  LDD0082  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7) 3-beta-HSD family Q9H2F3
Alkaline phosphatase, placental type (ALPP) Alkaline phosphatase family P05187
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Inactive glycosyltransferase 25 family member 3 (CERCAM) Glycosyltransferase 25 family Q5T4B2
Integrator complex subunit 11 (INTS11) RNA-metabolizing metallo-beta-lactamase-like family Q5TA45
Glutamine-dependent NAD(+) synthetase (NADSYN1) NAD synthetase family Q6IA69
Inactive Ufm1-specific protease 1 (UFSP1) Peptidase C78 family Q6NVU6
Retinol-binding protein 3 (RBP3) Peptidase S41A family P10745
Group 10 secretory phospholipase A2 (PLA2G10) Phospholipase A2 family O15496
RanBP-type and C3HC4-type zinc finger-containing protein 1 (RBCK1) RBR family Q9BYM8
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Speckle-type POZ protein-like (SPOPL) Tdpoz family Q6IQ16
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Ataxin-3 (ATXN3) . P54252
RING finger and CHY zinc finger domain-containing protein 1 (RCHY1) . Q96PM5
RING finger protein 208 (RNF208) . Q9H0X6
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
MyoD family inhibitor (MDFI) MDFI family Q99750
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Basic leucine zipper transcriptional factor ATF-like 3 (BATF3) BZIP family Q9NR55
Jun dimerization protein 2 (JDP2) BZIP family Q8WYK2
Fos-related antigen 1 (FOSL1) BZIP family P15407
Fos-related antigen 2 (FOSL2) BZIP family P15408
Protein c-Fos (FOS) BZIP family P01100
Protein FosB (FOSB) BZIP family P53539
DNA-binding protein inhibitor ID-3 (ID3) . Q02535
Protein AF-17 (MLLT6) . P55198
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Prosaposin receptor GPR37 (GPR37) G-protein coupled receptor 1 family O15354
Other
Click To Hide/Show 83 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) CDIP1/LITAF family Q99732
Cysteine-rich DPF motif domain-containing protein 1 (CDPF1) CDPF1 family Q6NVV7
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Cornifelin (CNFN) Cornifelin family Q9BYD5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
Progranulin (GRN) Granulin family P28799
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 1-5 (KRTAP1-5) KRTAP type 1 family Q9BYS1
Keratin-associated protein 10-10 (KRTAP10-10) KRTAP type 10 family P60014
Keratin-associated protein 10-11 (KRTAP10-11) KRTAP type 10 family P60412
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 19-2 (KRTAP19-2) KRTAP type 19 family Q3LHN2
Keratin-associated protein 19-3 (KRTAP19-3) KRTAP type 19 family Q7Z4W3
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 2-4 (KRTAP2-4) KRTAP type 2 family Q9BYR9
Keratin-associated protein 3-1 (KRTAP3-1) KRTAP type 3 family Q9BYR8
Keratin-associated protein 3-2 (KRTAP3-2) KRTAP type 3 family Q9BYR7
Keratin-associated protein 4-1 (KRTAP4-1) KRTAP type 4 family Q9BYQ7
Keratin-associated protein 4-12 (KRTAP4-12) KRTAP type 4 family Q9BQ66
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 4-4 (KRTAP4-4) KRTAP type 4 family Q9BYR3
Keratin-associated protein 4-5 (KRTAP4-5) KRTAP type 4 family Q9BYR2
Keratin-associated protein 5-11 (KRTAP5-11) KRTAP type 5 family Q6L8G4
Keratin-associated protein 5-2 (KRTAP5-2) KRTAP type 5 family Q701N4
Keratin-associated protein 5-4 (KRTAP5-4) KRTAP type 5 family Q6L8H1
Keratin-associated protein 5-6 (KRTAP5-6) KRTAP type 5 family Q6L8G9
Keratin-associated protein 5-7 (KRTAP5-7) KRTAP type 5 family Q6L8G8
Keratin-associated protein 5-9 (KRTAP5-9) KRTAP type 5 family P26371
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 7-1 (KRTAP7-1) KRTAP type 7 family Q8IUC3
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Keratin-associated protein 9-4 (KRTAP9-4) KRTAP type 9 family Q9BYQ2
Keratin-associated protein 9-8 (KRTAP9-8) KRTAP type 9 family Q9BYQ0
Late cornified envelope protein 1C (LCE1C) LCE family Q5T751
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Late cornified envelope protein 2C (LCE2C) LCE family Q5TA81
Late cornified envelope protein 4A (LCE4A) LCE family Q5TA78
Late cornified envelope protein 5A (LCE5A) LCE family Q5TCM9
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Zinc finger protein 330 (ZNF330) NOA36 family Q9Y3S2
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
RIMS-binding protein 3A (RIMBP3) RIMBP family Q9UFD9
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Protein sprouty homolog 2 (SPRY2) Sprouty family O43597
Protein sprouty homolog 3 (SPRY3) Sprouty family O43610
Protein sprouty homolog 4 (SPRY4) Sprouty family Q9C004
Tetraspanin-4 (TSPAN4) Tetraspanin (TM4SF) family O14817
Pre-rRNA-processing protein TSR2 homolog (TSR2) TSR2 family Q969E8
LIM domain-containing protein ajuba (AJUBA) Zyxin/ajuba family Q96IF1
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
Calcium and integrin-binding family member 4 (CIB4) . A0PJX0
Cobalamin trafficking protein CblD (MMADHC) . Q9H3L0
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
Follistatin (FST) . P19883
Four and a half LIM domains protein 3 (FHL3) . Q13643
Galactoside-binding soluble lectin 13 (LGALS13) . Q9UHV8
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Keratinocyte proline-rich protein (KPRP) . Q5T749
Regulator of G-protein signaling 17 (RGS17) . Q9UGC6
Regulator of G-protein signaling 20 (RGS20) . O76081
RNA-binding protein with multiple splicing (RBPMS) . Q93062
Spermatogenesis-associated protein 12 (SPATA12) . Q7Z6I5
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TP53-binding protein 1 (TP53BP1) . Q12888
Zinc finger matrin-type protein 5 (ZMAT5) . Q9UDW3

References

1 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
2 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
5 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402