Details of the Target

General Information of Target

Target ID LDTP05039
Target Name Vesicle-associated membrane protein 2 (VAMP2)
Gene Name VAMP2
Gene ID 6844
Synonyms
SYB2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Target Bioclass
Transporter and channel
Family
Synaptobrevin family
Subcellular location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane
Function
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Uniprot ID
P63027
Ensemble ID
ENST00000316509.11
HGNC ID
HGNC:12643
ChEMBL ID
CHEMBL2364160

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
FBPP2
 Probe Info  		38.09  LDD0318  [1]
AZ-9
 Probe Info  		E78(1.07)  LDD2208  [2]
AOyne
 Probe Info  		7.00  LDD0443  [3]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Staurosporine capture compound
 Probe Info  		N.A.  LDD0083  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0019  Staurosporine Hep-G2 N.A.  LDD0083  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transitional endoplasmic reticulum ATPase (VCP) AAA ATPase family P55072
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) HIBADH-related family P31937
Serine/threonine-protein kinase D3 (PRKD3) CAMK Ser/Thr protein kinase family O94806
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
Ceramide synthase 4 (CERS4) . Q9HA82
E3 ubiquitin-protein ligase MARCHF8 (MARCHF8) . Q5T0T0
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Sodium channel regulatory subunit beta-3 (SCN3B) Sodium channel auxiliary subunit SCN3B family Q9NY72
Syntaxin-1A (STX1A) Syntaxin family Q16623
Syntaxin-4 (STX4) Syntaxin family Q12846
Alpha-synuclein (SNCA) Synuclein family P37840
Transmembrane protein 101 (TMEM101) . Q96IK0
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein jagunal homolog 1 (JAGN1) Jagunal family Q8N5M9
Synaptosomal-associated protein 29 (SNAP29) SNAP-25 family O95721
Syntaxin-1B (STX1B) Syntaxin family P61266
Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) VMA21 family Q3ZAQ7
Protein KASH5 (KASH5) . Q8N6L0

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Botulinum Toxin Type B BiotechDrug DB00042

References

1 Tranylcypromine specificity for monoamine oxidase is limited by promiscuous protein labelling and lysosomal trapping. RSC Chem Biol. 2020 Aug 12;1(4):209-213. doi: 10.1039/d0cb00048e. eCollection 2020 Oct 1.
Mass spectrometry data entry: PXD018580
2 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
3 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
4 Comprehensive identification of staurosporine-binding kinases in the hepatocyte cell line HepG2 using Capture Compound Mass Spectrometry (CCMS). J Proteome Res. 2010 Feb 5;9(2):806-17. doi: 10.1021/pr9007333.