Details of the Target
General Information of Target
Target ID | LDTP04938 | |||||
---|---|---|---|---|---|---|
Target Name | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) | |||||
Gene Name | DAD1 | |||||
Gene ID | 1603 | |||||
Synonyms |
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1 |
|||||
3D Structure | ||||||
Sequence |
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
DAD/OST2 family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. Required for the assembly of both SST3A- and SS3B-containing OST complexes. Loss of the DAD1 protein triggers apoptosis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
6.86 | LDD0402 | [1] | |
CHEMBL5175495 Probe Info |
![]() |
7.45 | LDD0196 | [2] | |
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [3] | |
STPyne Probe Info |
![]() |
K82(20.00) | LDD2217 | [4] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [5] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STS-1 Probe Info |
![]() |
N.A. | LDD0136 | [6] | |
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [6] | |
Staurosporine capture compound Probe Info |
![]() |
N.A. | LDD0083 | [7] |
Competitor(s) Related to This Target
References